BLASTX nr result
ID: Paeonia24_contig00034001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034001 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93485.1| hypothetical protein L484_006960 [Morus notabilis] 64 2e-08 ref|XP_004299904.1| PREDICTED: uncharacterized protein At4g06598... 61 1e-07 ref|XP_002533021.1| Transcription factor RF2a, putative [Ricinus... 59 7e-07 ref|XP_006471240.1| PREDICTED: uncharacterized protein At4g06598... 58 1e-06 ref|XP_006431745.1| hypothetical protein CICLE_v10001528mg [Citr... 58 1e-06 ref|XP_007223048.1| hypothetical protein PRUPE_ppa006939mg [Prun... 57 3e-06 ref|XP_007159569.1| hypothetical protein PHAVU_002G248500g [Phas... 57 3e-06 ref|XP_007042281.1| Basic-leucine zipper transcription factor fa... 57 3e-06 ref|XP_003531297.1| PREDICTED: uncharacterized protein At4g06598... 55 8e-06 >gb|EXB93485.1| hypothetical protein L484_006960 [Morus notabilis] Length = 364 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS ++ N+ Y G+ A P ++P +S + DYI SPA+GS ++KP G HHQ Sbjct: 1 MANSKGSTNVRNLMYSGKHALLPPKSPFPSVSPSYADYILSPAIGSKAVQKPREGNTHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SE L E+Q Sbjct: 61 RTSSEGLLSEDQ 72 >ref|XP_004299904.1| PREDICTED: uncharacterized protein At4g06598-like [Fragaria vesca subsp. vesca] Length = 378 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + S ++ N+ Y G+ P ++P +S + DY+FSPA+GS I+KP G HHQ Sbjct: 1 MANSKSSSNMRNLMYSGKHPLLPPKSPFPSVSPSYADYVFSPAIGSKTIQKPREGNAHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SES EEQ Sbjct: 61 RTSSESLPIEEQ 72 >ref|XP_002533021.1| Transcription factor RF2a, putative [Ricinus communis] gi|223527183|gb|EEF29352.1| Transcription factor RF2a, putative [Ricinus communis] Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GSP++ N+ Y G+ A P + P +S + DY+ S +GS +++P G HHQ Sbjct: 1 MANSKGSPNVRNLMYSGKHALLPPKIPFPSVSPSYVDYVPSNVIGSKAVQRPREGNAHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SE+ L EEQ Sbjct: 61 RTSSETLLIEEQ 72 >ref|XP_006471240.1| PREDICTED: uncharacterized protein At4g06598-like isoform X1 [Citrus sinensis] gi|568834216|ref|XP_006471241.1| PREDICTED: uncharacterized protein At4g06598-like isoform X2 [Citrus sinensis] Length = 374 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS ++ N + G+ A P ++P IS A +DY+ + +G ++KP G +HHQ Sbjct: 1 MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SESFL EEQ Sbjct: 61 RTSSESFLMEEQ 72 >ref|XP_006431745.1| hypothetical protein CICLE_v10001528mg [Citrus clementina] gi|567878375|ref|XP_006431746.1| hypothetical protein CICLE_v10001528mg [Citrus clementina] gi|557533867|gb|ESR44985.1| hypothetical protein CICLE_v10001528mg [Citrus clementina] gi|557533868|gb|ESR44986.1| hypothetical protein CICLE_v10001528mg [Citrus clementina] Length = 374 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS ++ N + G+ A P ++P IS A +DY+ + +G ++KP G +HHQ Sbjct: 1 MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SESFL EEQ Sbjct: 61 RTSSESFLMEEQ 72 >ref|XP_007223048.1| hypothetical protein PRUPE_ppa006939mg [Prunus persica] gi|462419984|gb|EMJ24247.1| hypothetical protein PRUPE_ppa006939mg [Prunus persica] Length = 389 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -2 Query: 196 SPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQRSPSES 20 S ++ N Y G+ P ++P +S + DY+ SPA GS ++KP G HHQR+ SES Sbjct: 6 SSNIRNFMYSGKHPLLPPKSPFPSVSPSYADYVLSPAFGSKTVQKPREGNAHHQRTSSES 65 Query: 19 FLREEQ 2 L EEQ Sbjct: 66 LLIEEQ 71 >ref|XP_007159569.1| hypothetical protein PHAVU_002G248500g [Phaseolus vulgaris] gi|561032984|gb|ESW31563.1| hypothetical protein PHAVU_002G248500g [Phaseolus vulgaris] Length = 375 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS S N Y G+ A P ++P +S A DY+ +PAVG +P G HHQ Sbjct: 1 MANSKGSSSFRNFMYPGKHALLPPKSPFPSVSQAYADYVPNPAVGLKAGNRPREGNPHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SES + EEQ Sbjct: 61 RTSSESLVIEEQ 72 >ref|XP_007042281.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|590686105|ref|XP_007042282.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508706216|gb|EOX98112.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508706217|gb|EOX98113.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] Length = 376 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS ++ N+ + G+ A P ++P +S TDY+ + +GS ++KP G HHQ Sbjct: 1 MPNSKGSTNIRNLMFAGKHALLPPKSPFPTVSPTYTDYVPNNVIGSKAVQKPREGSTHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SES L +EQ Sbjct: 61 RTSSESLLIDEQ 72 >ref|XP_003531297.1| PREDICTED: uncharacterized protein At4g06598 [Glycine max] Length = 376 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = -2 Query: 214 MEQTNGSPSLMNIPYRGRPAPFPSQTPLQQISHA-TDYIFSPAVGSDCIRKPMGGQMHHQ 38 M + GS S N Y G+ P ++P +S A DY+ +PAVG +P G HHQ Sbjct: 1 MANSKGSSSFRNFMYPGKHPLLPPKSPFPSVSQAYADYVPNPAVGLKAGNRPRDGNTHHQ 60 Query: 37 RSPSESFLREEQ 2 R+ SES + EEQ Sbjct: 61 RTSSESLVIEEQ 72