BLASTX nr result
ID: Paeonia24_contig00033671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033671 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281079.2| PREDICTED: GTP-binding protein 5-like [Vitis... 57 3e-06 emb|CBI16141.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_002281079.2| PREDICTED: GTP-binding protein 5-like [Vitis vinifera] Length = 487 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 289 MWLRCAKPLQYSETLRKISKAQWHLSFLCSYSESP 393 MWLRCAKPLQY E LRK S++ HL FLC YS++P Sbjct: 1 MWLRCAKPLQYLEVLRKSSRSPCHLPFLCPYSDTP 35 >emb|CBI16141.3| unnamed protein product [Vitis vinifera] Length = 501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 289 MWLRCAKPLQYSETLRKISKAQWHLSFLCSYSESP 393 MWLRCAKPLQY E LRK S++ HL FLC YS++P Sbjct: 1 MWLRCAKPLQYLEVLRKSSRSPCHLPFLCPYSDTP 35