BLASTX nr result
ID: Paeonia24_contig00033423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033423 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26581.1| hypothetical protein MIMGU_mgv1a018412mg [Mimulus... 58 2e-06 >gb|EYU26581.1| hypothetical protein MIMGU_mgv1a018412mg [Mimulus guttatus] Length = 162 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -2 Query: 244 SHSNCPICRASIPGVKQRNNKSVGEEDDDLRQGLPDFASLV 122 SHS+CP+CRA++P + + VG EDDD RQGLPD A+L+ Sbjct: 122 SHSSCPVCRAAVPVKRSKRGSVVGREDDDFRQGLPDSANLI 162