BLASTX nr result
ID: Paeonia24_contig00033099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033099 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CBI16904.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN67492.1| hypothetical protein VITISV_035978 [Vitis vinifera] 57 3e-06 >ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Vitis vinifera] Length = 877 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 150 MRFFF-YLSKLPYKTLPVRTVSTIASSQTPAKRKTFSHIFQQCADRKPL 7 +RFFF + SK P+KTLP+ S+ + TP K+KTFSHIFQ+C+DRK L Sbjct: 12 IRFFFNFQSKSPFKTLPISPFSSYQA--TPTKKKTFSHIFQECSDRKAL 58 >emb|CBI16904.3| unnamed protein product [Vitis vinifera] Length = 843 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 150 MRFFF-YLSKLPYKTLPVRTVSTIASSQTPAKRKTFSHIFQQCADRKPL 7 +RFFF + SK P+KTLP+ S+ + TP K+KTFSHIFQ+C+DRK L Sbjct: 12 IRFFFNFQSKSPFKTLPISPFSSYQA--TPTKKKTFSHIFQECSDRKAL 58 >emb|CAN67492.1| hypothetical protein VITISV_035978 [Vitis vinifera] Length = 814 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 150 MRFFF-YLSKLPYKTLPVRTVSTIASSQTPAKRKTFSHIFQQCADRKPL 7 +RFFF + SK P+KTLP+ S+ + TP K+KTFSHIFQ+C+DRK L Sbjct: 12 IRFFFNFQSKSPFKTLPISPFSSYQA--TPTKKKTFSHIFQECSDRKAL 58