BLASTX nr result
ID: Paeonia24_contig00033044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033044 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523161.1| ATP binding protein, putative [Ricinus commu... 72 1e-10 ref|XP_002272986.1| PREDICTED: probable receptor-like protein ki... 62 1e-07 ref|XP_007219225.1| hypothetical protein PRUPE_ppa017272mg [Prun... 58 1e-06 ref|XP_007217962.1| hypothetical protein PRUPE_ppa005239mg [Prun... 56 6e-06 ref|XP_004309183.1| PREDICTED: probable receptor-like protein ki... 55 8e-06 >ref|XP_002523161.1| ATP binding protein, putative [Ricinus communis] gi|223537568|gb|EEF39192.1| ATP binding protein, putative [Ricinus communis] Length = 831 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -1 Query: 181 METKILPRFLSFMFLSLLTAPFSTPFTPQDNYLISCGSNTNITIDNRIFVGDSGKAGLF 5 METK L FLS +F+SLL++ ST FTP DNYL++CGS TN ++DNR+FV DS K+G F Sbjct: 1 METKAL-HFLSLVFMSLLSSS-STSFTPTDNYLLNCGSTTNTSLDNRVFVSDSSKSGWF 57 >ref|XP_002272986.1| PREDICTED: probable receptor-like protein kinase At5g24010 [Vitis vinifera] Length = 822 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 157 FLSFMFLSLLTAPFSTPFTPQDNYLISCGSNTNITIDNRIFVGDSGK 17 FLS LSLL FS+ FTP DN+LI+CGS++N T+DNR+FVGDS K Sbjct: 4 FLSLTLLSLLH--FSSSFTPLDNFLINCGSSSNSTVDNRVFVGDSAK 48 >ref|XP_007219225.1| hypothetical protein PRUPE_ppa017272mg [Prunus persica] gi|462415687|gb|EMJ20424.1| hypothetical protein PRUPE_ppa017272mg [Prunus persica] Length = 820 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/57 (57%), Positives = 39/57 (68%) Frame = -1 Query: 181 METKILPRFLSFMFLSLLTAPFSTPFTPQDNYLISCGSNTNITIDNRIFVGDSGKAG 11 METK L FLS LSLL FS FTP DNYL++CGS +N ++ NR+F GDS K G Sbjct: 1 METKNL-HFLSLTLLSLLH--FSASFTPLDNYLLNCGSLSNTSLFNRVFAGDSYKPG 54 >ref|XP_007217962.1| hypothetical protein PRUPE_ppa005239mg [Prunus persica] gi|462414424|gb|EMJ19161.1| hypothetical protein PRUPE_ppa005239mg [Prunus persica] Length = 471 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -1 Query: 157 FLSFMFLSLLTAPFSTPFTPQDNYLISCGSNTNITIDNRIFVGDSGK 17 FLS + LS L+A +PF+P DN+L+ CGS T+DNR+FV DS K Sbjct: 11 FLSILSLSTLSALSHSPFSPVDNFLVDCGSTVGSTVDNRLFVPDSAK 57 >ref|XP_004309183.1| PREDICTED: probable receptor-like protein kinase At5g24010-like [Fragaria vesca subsp. vesca] Length = 829 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -1 Query: 157 FLSFMFLSLLTAPFSTPFTPQDNYLISCGSNTNITIDNRIFVGDSGKAGLF 5 FLS LSLL FS FTP DNYL++CGS++N ++ NR+F+GDS F Sbjct: 6 FLSLTLLSLLH--FSASFTPSDNYLLNCGSSSNASLFNRVFLGDSNSGSGF 54