BLASTX nr result
ID: Paeonia24_contig00032666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00032666 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433136.1| hypothetical protein CICLE_v10000115mg [Citr... 70 2e-10 >ref|XP_006433136.1| hypothetical protein CICLE_v10000115mg [Citrus clementina] gi|568835509|ref|XP_006471810.1| PREDICTED: FRIGIDA-like protein 5-like [Citrus sinensis] gi|557535258|gb|ESR46376.1| hypothetical protein CICLE_v10000115mg [Citrus clementina] Length = 1060 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/85 (41%), Positives = 60/85 (70%) Frame = +3 Query: 6 IEERFEEIGVKEKHCTLLQSLVVEHFQKVELKEKTLDSVSKSIEERVKEVDLKEKECVLF 185 IEE +E+ +KEKH + LQSL+ ++ +++E KEK D + KSI + ++D K+KE L Sbjct: 189 IEECEKELVMKEKHASSLQSLIEDYAEELESKEKLYDEIKKSIIQCETKLDCKKKELELT 248 Query: 186 QRSVVERSQAVELEEKRLDSLRKLI 260 Q S++E S + LEE++L+SL++++ Sbjct: 249 QTSIIELSLELHLEEEKLESLQRIV 273