BLASTX nr result
ID: Paeonia24_contig00032052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00032052 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836856.1| hypothetical protein AMTR_s00099p00085080 [A... 65 1e-08 >ref|XP_006836856.1| hypothetical protein AMTR_s00099p00085080 [Amborella trichopoda] gi|548839420|gb|ERM99709.1| hypothetical protein AMTR_s00099p00085080 [Amborella trichopoda] Length = 527 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/74 (47%), Positives = 50/74 (67%) Frame = +3 Query: 6 PLNRLLS**GKEDLLPEMVVGASAEDESSIRPSTYLAKWGKKLFIGRIPIEATVVDAQLY 185 P +R+ S G + LP +VG + E+ S+ S AKWGKKLF+GRIPIEA VD +++ Sbjct: 336 PSDRVPSSLGNDSDLPSEMVGVATEN-GSVAHSAPPAKWGKKLFVGRIPIEANAVDVRVH 394 Query: 186 FNHFGHVLNVHLFK 227 F+ +G VL+V+L K Sbjct: 395 FSQYGPVLDVYLPK 408