BLASTX nr result
ID: Paeonia24_contig00031865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031865 (170 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283780.1| PREDICTED: allene oxide synthase, chloroplas... 108 8e-22 ref|XP_006434896.1| hypothetical protein CICLE_v10000825mg [Citr... 108 1e-21 ref|XP_006473410.1| PREDICTED: allene oxide synthase, chloroplas... 106 3e-21 ref|XP_006375037.1| hypothetical protein POPTR_0014s03820g [Popu... 106 3e-21 gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [P... 106 3e-21 gb|ACZ67202.1| cytochrome P450 allene oxide synthase [Populus ni... 106 3e-21 gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus de... 106 3e-21 gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus ba... 106 3e-21 ref|XP_007017426.1| Allene oxide synthase [Theobroma cacao] gi|5... 105 7e-21 dbj|BAM76723.1| allene oxyde synthase [Nicotiana tabacum] 105 7e-21 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 105 7e-21 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 105 7e-21 emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] 105 7e-21 ref|XP_003523882.2| PREDICTED: allene oxide synthase, chloroplas... 105 9e-21 ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|4... 104 1e-20 ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 104 1e-20 gb|EXC07343.1| Allene oxide synthase [Morus notabilis] 104 1e-20 emb|CAC82911.1| allene oxide synthase [Nicotiana attenuata] 104 1e-20 emb|CAA63266.1| allene oxide synthase [Arabidopsis thaliana] 104 1e-20 ref|NP_001275835.1| allene oxide synthase [Citrus sinensis] gi|2... 104 1e-20 >ref|XP_002283780.1| PREDICTED: allene oxide synthase, chloroplastic [Vitis vinifera] Length = 520 Score = 108 bits (270), Expect = 8e-22 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFER++EFVPDRFVGEGE+LLKHVLWSNGPETE+PT+G+KQCAGKDFVVL + Sbjct: 428 KDPKIFERSEEFVPDRFVGEGEKLLKHVLWSNGPETENPTLGNKQCAGKDFVVLAA 483 >ref|XP_006434896.1| hypothetical protein CICLE_v10000825mg [Citrus clementina] gi|557537018|gb|ESR48136.1| hypothetical protein CICLE_v10000825mg [Citrus clementina] Length = 532 Score = 108 bits (269), Expect = 1e-21 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFERA+EFV DRFVGEGE++LKHVLWSNGPETE+PTVG+KQCAGKDFVVL S Sbjct: 440 KDPKIFERAEEFVADRFVGEGEKMLKHVLWSNGPETENPTVGNKQCAGKDFVVLAS 495 >ref|XP_006473410.1| PREDICTED: allene oxide synthase, chloroplastic [Citrus sinensis] Length = 532 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFE+A+EFV DRFVGEGE++LKHVLWSNGPETE+PTVG+KQCAGKDFVVL S Sbjct: 440 KDPKIFEQAEEFVADRFVGEGEKMLKHVLWSNGPETENPTVGNKQCAGKDFVVLAS 495 >ref|XP_006375037.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa] gi|550323351|gb|ERP52834.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa] Length = 526 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF RA+EFV DRF+GEGEELLKHVLWSNGPETE PT+G+KQCAGKDFVVLV+ Sbjct: 434 KDPKIFTRAEEFVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVA 489 >gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [Populus laurifolia] Length = 210 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF RA+EFV DRF+GEGEELLKHVLWSNGPETE PT+G+KQCAGKDFVVLV+ Sbjct: 118 KDPKIFTRAEEFVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVA 173 >gb|ACZ67202.1| cytochrome P450 allene oxide synthase [Populus nigra] Length = 227 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF RA+EFV DRF+GEGEELLKHVLWSNGPETE PT+G+KQCAGKDFVVLV+ Sbjct: 135 KDPKIFTRAEEFVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVA 190 >gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus deltoides] Length = 227 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF RA+EFV DRF+GEGEELLKHVLWSNGPETE PT+G+KQCAGKDFVVLV+ Sbjct: 135 KDPKIFTRAEEFVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVA 190 >gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus balsamifera] Length = 227 Score = 106 bits (265), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF RA+EFV DRF+GEGEELLKHVLWSNGPETE PT+G+KQCAGKDFVVLV+ Sbjct: 135 KDPKIFTRAEEFVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVA 190 >ref|XP_007017426.1| Allene oxide synthase [Theobroma cacao] gi|508722754|gb|EOY14651.1| Allene oxide synthase [Theobroma cacao] Length = 531 Score = 105 bits (262), Expect = 7e-21 Identities = 49/57 (85%), Positives = 56/57 (98%), Gaps = 1/57 (1%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGE-GEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFER++EFVPDRFVG+ GE+LLKHVLWSNGPETE+PT+G+KQCAGKDFVVLVS Sbjct: 438 KDPKIFERSEEFVPDRFVGDDGEKLLKHVLWSNGPETENPTLGNKQCAGKDFVVLVS 494 >dbj|BAM76723.1| allene oxyde synthase [Nicotiana tabacum] Length = 522 Score = 105 bits (262), Expect = 7e-21 Identities = 51/57 (89%), Positives = 54/57 (94%), Gaps = 1/57 (1%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGE-GEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+R DEFVPDRFVGE GE+LLKHVLWSNGPETESPTV +KQCAGKDFVVLVS Sbjct: 431 KDPKIFDRPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVS 487 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 105 bits (262), Expect = 7e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+R +EFV DRFVGEGE+LLK+VLWSNGPETESPTVG+KQCAGKDFVV+VS Sbjct: 419 KDPKIFDRPEEFVADRFVGEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVS 474 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 105 bits (262), Expect = 7e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+R +EFV DRFVGEGE+LLK+VLWSNGPETESPTVG+KQCAGKDFVV+VS Sbjct: 419 KDPKIFDRPEEFVADRFVGEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVS 474 >emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] Length = 509 Score = 105 bits (262), Expect = 7e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+R +EFV DRFVGEGE+LLK+VLWSNGPETESPTVG+KQCAGKDFVV+VS Sbjct: 419 KDPKIFDRPEEFVADRFVGEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVS 474 >ref|XP_003523882.2| PREDICTED: allene oxide synthase, chloroplastic-like [Glycine max] Length = 521 Score = 105 bits (261), Expect = 9e-21 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFE A+EFV DRFVGEGE+LLKHVLWSNGPETE PT+G+KQCAGKDFVVL S Sbjct: 429 KDPKIFENAEEFVADRFVGEGEKLLKHVLWSNGPETEGPTLGNKQCAGKDFVVLFS 484 >ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|449470021|ref|XP_004152717.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449470023|ref|XP_004152718.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449496035|ref|XP_004160018.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis sativus] gi|557367638|gb|AGZ95026.1| allene oxide synthase [Cucumis sativus] Length = 532 Score = 104 bits (260), Expect = 1e-20 Identities = 45/56 (80%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 +DPKIF+RADEFVPDRF G+GEELLKHVLWSNGPET+SP+V +KQCAGKDF+V +S Sbjct: 440 RDPKIFDRADEFVPDRFTGDGEELLKHVLWSNGPETQSPSVQNKQCAGKDFIVFIS 495 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 104 bits (260), Expect = 1e-20 Identities = 45/56 (80%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+R +E+VPDRFVGEGE+LL+HVLWSNGPETE PT+G+KQCAGKDFVV +S Sbjct: 426 KDPKIFDRPEEYVPDRFVGEGEKLLQHVLWSNGPETEHPTIGNKQCAGKDFVVFIS 481 >gb|EXC07343.1| Allene oxide synthase [Morus notabilis] Length = 525 Score = 104 bits (259), Expect = 1e-20 Identities = 50/57 (87%), Positives = 53/57 (92%), Gaps = 1/57 (1%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGE-GEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIF+RA+EFVPDRFVGE GE LLKHVLWSNGPETESPTVG+KQCAGKD VVL S Sbjct: 432 KDPKIFDRAEEFVPDRFVGEEGERLLKHVLWSNGPETESPTVGNKQCAGKDLVVLFS 488 >emb|CAC82911.1| allene oxide synthase [Nicotiana attenuata] Length = 519 Score = 104 bits (259), Expect = 1e-20 Identities = 50/57 (87%), Positives = 54/57 (94%), Gaps = 1/57 (1%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGE-GEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 +DPKIF+R DEFVPDRFVGE GE+LLKHVLWSNGPETESPTV +KQCAGKDFVVLVS Sbjct: 428 RDPKIFDRPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVS 484 >emb|CAA63266.1| allene oxide synthase [Arabidopsis thaliana] Length = 517 Score = 104 bits (259), Expect = 1e-20 Identities = 48/57 (84%), Positives = 56/57 (98%), Gaps = 1/57 (1%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGE-GEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 +DPKIF+RADEFVP+RFVGE GE+LL+HVLWSNGPETE+PTVG+KQCAGKDFVVLV+ Sbjct: 424 RDPKIFDRADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVA 480 >ref|NP_001275835.1| allene oxide synthase [Citrus sinensis] gi|29373135|gb|AAO72741.1| allene oxide synthase [Citrus sinensis] Length = 532 Score = 104 bits (259), Expect = 1e-20 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -1 Query: 170 KDPKIFERADEFVPDRFVGEGEELLKHVLWSNGPETESPTVGDKQCAGKDFVVLVS 3 KDPKIFE+A+EFV DRFVGEGE++LKHVLWSNGPETE+P VG+KQCAGKDFVVL S Sbjct: 440 KDPKIFEQAEEFVADRFVGEGEKMLKHVLWSNGPETENPPVGNKQCAGKDFVVLAS 495