BLASTX nr result
ID: Paeonia24_contig00031682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031682 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849936.1| hypothetical protein AMTR_s00022p00124240 [A... 57 3e-06 >ref|XP_006849936.1| hypothetical protein AMTR_s00022p00124240 [Amborella trichopoda] gi|548853534|gb|ERN11517.1| hypothetical protein AMTR_s00022p00124240 [Amborella trichopoda] Length = 513 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/63 (42%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = -3 Query: 379 DYALGYDLYGANTNGIDMDNYKRHFDIPDAILIKRCNDDDKCLEK---RPSEIASMAGEL 209 DYALGYDLYGANTN +D++ Y R F +PD +L+K+ ++ + ++ RP ++ S+ E+ Sbjct: 369 DYALGYDLYGANTNDLDLEKY-RGFSLPDVVLVKKSYEEKRQKKRGKARPWKLKSLPMEV 427 Query: 208 QES 200 + S Sbjct: 428 ENS 430