BLASTX nr result
ID: Paeonia24_contig00031676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031676 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516789.1| conserved hypothetical protein [Ricinus comm... 43 3e-06 ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216... 42 1e-05 >ref|XP_002516789.1| conserved hypothetical protein [Ricinus communis] gi|223543877|gb|EEF45403.1| conserved hypothetical protein [Ricinus communis] Length = 1325 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -1 Query: 338 LLKGCTPTWVLEMDRDTDVLWKLRKGLSQCNEDELPL 228 L+ GC P+WVLE+ D DVL +L KGL Q NE EL L Sbjct: 1269 LMVGCAPSWVLEV--DADVLKRLSKGLRQWNEGELAL 1303 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 414 IASVFNVKILLGCDWLSW*TYMYGVVA 334 +AS + KI LGCDW +W +Y+ G V+ Sbjct: 1242 LASALDGKISLGCDWATWRSYVSGFVS 1268 >ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216833 [Cucumis sativus] Length = 2712 Score = 41.6 bits (96), Expect(2) = 1e-05 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -1 Query: 338 LLKGCTPTWVLEMDRDTDVLWKLRKGLSQCNEDELPL 228 L+ GCTP+WVL D D +VL +L GL Q NE+EL L Sbjct: 2655 LMVGCTPSWVL--DVDVEVLKRLSSGLRQWNEEELAL 2689 Score = 33.1 bits (74), Expect(2) = 1e-05 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 414 IASVFNVKILLGCDWLSW*TYMYGVVA 334 +AS + KI LGCDW +W Y+ G V+ Sbjct: 2628 LASALDGKISLGCDWATWRAYVTGFVS 2654