BLASTX nr result
ID: Paeonia24_contig00031540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031540 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus c... 56 6e-06 >ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus communis] gi|223536698|gb|EEF38339.1| Heterochromatin protein, putative [Ricinus communis] Length = 462 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 1 PESTNTWEPPEHLQSCYDIVENFEESLRRKQKTPGRGRRKRKYGV 135 PE+ NTWEP E+LQSC D+++ FEESLR + + +RKRKYGV Sbjct: 144 PEAANTWEPLENLQSCSDVIDAFEESLRSGKSS---RKRKRKYGV 185