BLASTX nr result
ID: Paeonia24_contig00031135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031135 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214486.1| hypothetical protein PRUPE_ppa020620mg [Prun... 62 1e-07 >ref|XP_007214486.1| hypothetical protein PRUPE_ppa020620mg [Prunus persica] gi|462410351|gb|EMJ15685.1| hypothetical protein PRUPE_ppa020620mg [Prunus persica] Length = 385 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -1 Query: 148 EMEGDKIQGLNNN--HVEPEYFESFPPGFRFNPTDEELIVYYLNRKVFNQ 5 E+ D+ NNN + E E+F+SFPPG+RFNP DEEL+V+YL +KV +Q Sbjct: 58 ELSDDESNSFNNNLKNEEDEFFDSFPPGYRFNPLDEELVVHYLKKKVLDQ 107