BLASTX nr result
ID: Paeonia24_contig00030855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030855 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483113.1| PREDICTED: Fructose-bisphosphate aldolase-ly... 63 4e-08 ref|XP_006348754.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 63 4e-08 ref|XP_006438744.1| hypothetical protein CICLE_v10031325mg [Citr... 63 4e-08 ref|XP_004239106.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 63 4e-08 ref|XP_007046008.1| Rubisco methyltransferase family protein [Th... 61 2e-07 sp|P94026.1|RBCMT_TOBAC RecName: Full=Ribulose-1,5 bisphosphate ... 60 2e-07 ref|XP_004159992.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 60 3e-07 ref|XP_004138924.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 60 3e-07 gb|EXC20017.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase l... 60 4e-07 ref|XP_002311320.2| Ribulose-1 family protein [Populus trichocar... 60 4e-07 gb|EYU28796.1| hypothetical protein MIMGU_mgv1a005377mg [Mimulus... 59 9e-07 ref|XP_002267249.1| PREDICTED: probable ribulose-1,5 bisphosphat... 59 9e-07 ref|XP_002892783.1| hypothetical protein ARALYDRAFT_471564 [Arab... 57 2e-06 gb|ABR17345.1| unknown [Picea sitchensis] 57 2e-06 ref|NP_172856.1| [fructose-bisphosphate aldolase]-lysine N-methy... 57 3e-06 ref|XP_006417064.1| hypothetical protein EUTSA_v10007614mg [Eutr... 57 3e-06 gb|AAF79410.1|AC068197_20 F16A14.25 [Arabidopsis thaliana] 57 3e-06 ref|XP_004298409.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 57 3e-06 ref|XP_007222120.1| hypothetical protein PRUPE_ppa004634mg [Prun... 57 3e-06 ref|XP_002522479.1| Ribulose-1,5 bisphosphate carboxylase/oxygen... 57 3e-06 >ref|XP_006483113.1| PREDICTED: Fructose-bisphosphate aldolase-lysine N-methyltransferase, chloroplastic-like [Citrus sinensis] Length = 497 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELDELEYYQERRL+DLGL GE G+IIFWEPK Sbjct: 466 LELDELEYYQERRLKDLGLVGEQGDIIFWEPK 497 >ref|XP_006348754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Solanum tuberosum] Length = 488 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELDELEYYQERRL+DLGL GE G+IIFWEPK Sbjct: 457 LELDELEYYQERRLKDLGLVGEQGDIIFWEPK 488 >ref|XP_006438744.1| hypothetical protein CICLE_v10031325mg [Citrus clementina] gi|557540940|gb|ESR51984.1| hypothetical protein CICLE_v10031325mg [Citrus clementina] Length = 497 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELDELEYYQERRL+DLGL GE G+IIFWEPK Sbjct: 466 LELDELEYYQERRLKDLGLVGEQGDIIFWEPK 497 >ref|XP_004239106.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Solanum lycopersicum] Length = 488 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELDELEYYQERRL+DLGL GE G+IIFWEPK Sbjct: 457 LELDELEYYQERRLKDLGLVGEQGDIIFWEPK 488 >ref|XP_007046008.1| Rubisco methyltransferase family protein [Theobroma cacao] gi|508709943|gb|EOY01840.1| Rubisco methyltransferase family protein [Theobroma cacao] Length = 496 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 ELDELEYYQERRLRDLGL GE GEIIFWE K Sbjct: 466 ELDELEYYQERRLRDLGLVGEQGEIIFWETK 496 >sp|P94026.1|RBCMT_TOBAC RecName: Full=Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic; AltName: Full=[Ribulose-bisphosphate carboxylase]-lysine N-methyltransferase; Short=RuBisCO LSMT; Short=RuBisCO methyltransferase; Short=rbcMT; Flags: Precursor gi|1731475|gb|AAC49565.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Nicotiana tabacum] gi|1731477|gb|AAC49566.1| ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Nicotiana tabacum] Length = 491 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELDELEYY ERRL+DLGL GE G+IIFWEPK Sbjct: 460 LELDELEYYGERRLKDLGLVGEQGDIIFWEPK 491 >ref|XP_004159992.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Cucumis sativus] Length = 503 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD+LEYYQERRL+DLGL GE GEIIFWE K Sbjct: 472 LELDQLEYYQERRLKDLGLCGEQGEIIFWETK 503 >ref|XP_004138924.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Cucumis sativus] Length = 503 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD+LEYYQERRL+DLGL GE GEIIFWE K Sbjct: 472 LELDQLEYYQERRLKDLGLCGEQGEIIFWETK 503 >gb|EXC20017.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Morus notabilis] Length = 496 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD LEYYQERRL++LGL GE GEIIFWEPK Sbjct: 465 LELDLLEYYQERRLKELGLCGEQGEIIFWEPK 496 >ref|XP_002311320.2| Ribulose-1 family protein [Populus trichocarpa] gi|550332698|gb|EEE88687.2| Ribulose-1 family protein [Populus trichocarpa] Length = 493 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 ELDELEYYQERRL+DLGL GE GEIIFWE K Sbjct: 463 ELDELEYYQERRLKDLGLVGEQGEIIFWESK 493 >gb|EYU28796.1| hypothetical protein MIMGU_mgv1a005377mg [Mimulus guttatus] Length = 486 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 ELD LEYYQERRL+DLGL GE G+IIFWEPK Sbjct: 456 ELDFLEYYQERRLKDLGLVGEQGDIIFWEPK 486 >ref|XP_002267249.1| PREDICTED: probable ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic [Vitis vinifera] gi|296087793|emb|CBI35049.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 ELD+LEYYQERRL+DLGL GE GEIIFWE K Sbjct: 454 ELDQLEYYQERRLKDLGLCGEQGEIIFWESK 484 >ref|XP_002892783.1| hypothetical protein ARALYDRAFT_471564 [Arabidopsis lyrata subsp. lyrata] gi|297338625|gb|EFH69042.1| hypothetical protein ARALYDRAFT_471564 [Arabidopsis lyrata subsp. lyrata] Length = 482 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD LEYYQERRL+DLGL GE G+IIFWE K Sbjct: 451 LELDVLEYYQERRLKDLGLVGEQGDIIFWETK 482 >gb|ABR17345.1| unknown [Picea sitchensis] Length = 350 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 361 DELEYYQERRLRDLGLAGELGEIIFWEPK 275 D+LEYYQERRL++LGL GE+GEIIFWEPK Sbjct: 322 DQLEYYQERRLKNLGLMGEIGEIIFWEPK 350 >ref|NP_172856.1| [fructose-bisphosphate aldolase]-lysine N-methyltransferase [Arabidopsis thaliana] gi|17369870|sp|Q9XI84.1|RBCMT_ARATH RecName: Full=[Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic; AltName: Full=Aldolases N-methyltransferase; AltName: Full=[Ribulose-bisphosphate carboxylase]-lysine N-methyltransferase-like; Short=AtLSMT-L; Short=LSMT-like enzyme; Flags: Precursor gi|5080779|gb|AAD39289.1|AC007576_12 Putative ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Arabidopsis thaliana] gi|28973755|gb|AAO64193.1| putative ribulose-1,5 bisphosphate carboxylase oxygenase large subunit N-methyltransferase [Arabidopsis thaliana] gi|332190979|gb|AEE29100.1| [fructose-bisphosphate aldolase]-lysine N-methyltransferase [Arabidopsis thaliana] Length = 482 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD LEYYQERRL+DLGL GE G+IIFWE K Sbjct: 451 LELDILEYYQERRLKDLGLVGEQGDIIFWETK 482 >ref|XP_006417064.1| hypothetical protein EUTSA_v10007614mg [Eutrema salsugineum] gi|557094835|gb|ESQ35417.1| hypothetical protein EUTSA_v10007614mg [Eutrema salsugineum] Length = 450 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWE 281 LELD LEYYQERRL+DLGL GE GEIIFWE Sbjct: 421 LELDVLEYYQERRLKDLGLVGEQGEIIFWE 450 >gb|AAF79410.1|AC068197_20 F16A14.25 [Arabidopsis thaliana] Length = 474 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 370 LELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 LELD LEYYQERRL+DLGL GE G+IIFWE K Sbjct: 443 LELDILEYYQERRLKDLGLVGEQGDIIFWETK 474 >ref|XP_004298409.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 597 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWE 281 ELD LEYYQERRL+DLGL+GELG+IIFWE Sbjct: 568 ELDILEYYQERRLKDLGLSGELGDIIFWE 596 >ref|XP_007222120.1| hypothetical protein PRUPE_ppa004634mg [Prunus persica] gi|462419056|gb|EMJ23319.1| hypothetical protein PRUPE_ppa004634mg [Prunus persica] Length = 499 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 EL +LEYYQERRL+DLGL GEL +IIFWEPK Sbjct: 469 ELRQLEYYQERRLKDLGLCGELEDIIFWEPK 499 >ref|XP_002522479.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] gi|223538364|gb|EEF39971.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] Length = 502 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 367 ELDELEYYQERRLRDLGLAGELGEIIFWEPK 275 ELDE EYYQERRL++LGL GE GEIIFWE K Sbjct: 472 ELDEFEYYQERRLKELGLVGEQGEIIFWESK 502