BLASTX nr result
ID: Paeonia24_contig00030843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030843 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213669.1| hypothetical protein PRUPE_ppa001022mg [Prun... 60 2e-07 ref|XP_007038696.1| Disease resistance family protein / LRR fami... 59 5e-07 ref|XP_007038695.1| Disease resistance family protein / LRR fami... 59 9e-07 >ref|XP_007213669.1| hypothetical protein PRUPE_ppa001022mg [Prunus persica] gi|462409534|gb|EMJ14868.1| hypothetical protein PRUPE_ppa001022mg [Prunus persica] Length = 932 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 204 LVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQKQDT 85 L I++KSNW PPFQL+++ MES K GTQ PQWLLTQK T Sbjct: 448 LTIRVKSNWEPPFQLKHVRMESCKFGTQFPQWLLTQKTIT 487 >ref|XP_007038696.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508775941|gb|EOY23197.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 966 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 204 LVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQ 97 L I +KSNW+PPFQLEYI MES K GT+ PQWL TQ Sbjct: 445 LTITIKSNWVPPFQLEYIEMESCKFGTEFPQWLQTQ 480 >ref|XP_007038695.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508775940|gb|EOY23196.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 966 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 204 LVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQKQDTEL 79 L IK+KSNW+PPFQLE I M S K GTQ PQWL TQ + T L Sbjct: 446 LTIKIKSNWVPPFQLECIEMGSCKFGTQFPQWLRTQLKATTL 487