BLASTX nr result
ID: Paeonia24_contig00030585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030585 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277367.2| PREDICTED: LOW QUALITY PROTEIN: nudix hydrol... 55 8e-06 emb|CBI21254.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_004306324.1| PREDICTED: nudix hydrolase 13, mitochondrial... 55 1e-05 >ref|XP_002277367.2| PREDICTED: LOW QUALITY PROTEIN: nudix hydrolase 12, mitochondrial [Vitis vinifera] Length = 218 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 92 MSSVQARTGRQLQRYDNNLRLVSGCIPYR 6 MS+VQARTGR QRY+NNLRLVSGCIPYR Sbjct: 1 MSTVQARTGRHRQRYENNLRLVSGCIPYR 29 >emb|CBI21254.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 92 MSSVQARTGRQLQRYDNNLRLVSGCIPYR 6 MS+VQARTGR QRY+NNLRLVSGCIPYR Sbjct: 1 MSTVQARTGRHRQRYENNLRLVSGCIPYR 29 >ref|XP_004306324.1| PREDICTED: nudix hydrolase 13, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 257 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 MSSVQARTGRQLQRYDNNLRLVSGCIPYRL 3 MSSV ARTGR+ QRY+NNLRLVSGCIPYR+ Sbjct: 1 MSSVLARTGRRRQRYENNLRLVSGCIPYRI 30