BLASTX nr result
ID: Paeonia24_contig00030137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030137 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB57553.1| hypothetical protein L484_022659 [Morus notabilis] 56 4e-06 >gb|EXB57553.1| hypothetical protein L484_022659 [Morus notabilis] Length = 613 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = -2 Query: 158 FVSNQSLFKIL---HKFYHLTSATHLNNLLNTSNQTKSIKHATQIHSQIITN 12 F+S+ SLFK+ K +S THLNNLLN + QTK++KHA++IH+Q+ITN Sbjct: 14 FLSSPSLFKLFVHTSKITPSSSPTHLNNLLNNTIQTKNLKHASEIHAQLITN 65