BLASTX nr result
ID: Paeonia24_contig00030135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030135 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007022075.1| LRR and NB-ARC domains-containing disease re... 61 1e-07 ref|XP_007022074.1| LRR and NB-ARC domains-containing disease re... 61 1e-07 ref|XP_007010950.1| LRR and NB-ARC domains-containing disease re... 58 1e-06 ref|XP_006494355.1| PREDICTED: putative disease resistance RPP13... 58 2e-06 ref|XP_006470799.1| PREDICTED: putative disease resistance prote... 57 3e-06 ref|XP_006420407.1| hypothetical protein CICLE_v10004188mg [Citr... 57 3e-06 ref|XP_007022068.1| LRR and NB-ARC domains-containing disease re... 56 5e-06 >ref|XP_007022075.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 2 [Theobroma cacao] gi|508721703|gb|EOY13600.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 2 [Theobroma cacao] Length = 1399 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/60 (53%), Positives = 41/60 (68%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKFRRKEGGEQVER 184 PSL LCI DCP+L+GT P+ + SL+ L I C QLV+S+S+LPKL K + E E V R Sbjct: 870 PSLVELCISDCPQLLGTLPNRLHSLKKLAIGFCRQLVVSLSNLPKLSKLQICECAELVLR 929 >ref|XP_007022074.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 1 [Theobroma cacao] gi|508721702|gb|EOY13599.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 1 [Theobroma cacao] Length = 1553 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/60 (53%), Positives = 41/60 (68%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKFRRKEGGEQVER 184 PSL LCI DCP+L+GT P+ + SL+ L I C QLV+S+S+LPKL K + E E V R Sbjct: 1024 PSLVELCISDCPQLLGTLPNRLHSLKKLAIGFCRQLVVSLSNLPKLSKLQICECAELVLR 1083 >ref|XP_007010950.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727863|gb|EOY19760.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1135 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/63 (46%), Positives = 41/63 (65%) Frame = +2 Query: 11 LKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKFRRKEGGEQVERSS 190 L+ L +K+CP+LV T P+ + SLE L+I NC +L +S+S+LP LC+F E V S Sbjct: 816 LRELLLKNCPKLVRTLPNDLHSLEKLVIRNCQELTVSVSNLPMLCEFEIDGCKEVVLESF 875 Query: 191 DGL 199 D L Sbjct: 876 DDL 878 >ref|XP_006494355.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Citrus sinensis] Length = 1458 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKF 151 P L+ L I C +L GT P H+ +LE L+IE C +L +SISSLP LCKF Sbjct: 891 PKLRELHILRCSKLQGTFPEHLLALEKLVIEGCEELSVSISSLPALCKF 939 >ref|XP_006470799.1| PREDICTED: putative disease resistance protein At3g14460-like [Citrus sinensis] Length = 726 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKF 151 P L+ L I C +L GT P H+ +LE L+IE C +L++S+SSLP LCKF Sbjct: 95 PKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKF 143 >ref|XP_006420407.1| hypothetical protein CICLE_v10004188mg [Citrus clementina] gi|557522280|gb|ESR33647.1| hypothetical protein CICLE_v10004188mg [Citrus clementina] Length = 1146 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKLCKFR 154 P L+ L IK CP+L G P+H+ SLE ++I C QLV+S+ SLP CK + Sbjct: 875 PHLRKLSIKKCPKLSGRLPNHLPSLEKIVITECMQLVVSLPSLPAACKLK 924 >ref|XP_007022068.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508721696|gb|EOY13593.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 941 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +2 Query: 5 PSLKGLCIKDCPELVGTSPSHVCSLENLIIENCPQLVISISSLPKL 142 PSL L IK+CP+L+G P+H+ SLE L I +C Q+V+S+S LPKL Sbjct: 748 PSLIELSIKNCPQLLGRLPNHLRSLEKLEIRDCAQMVVSLSDLPKL 793