BLASTX nr result
ID: Paeonia24_contig00030018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030018 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22718.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN83502.1| hypothetical protein VITISV_025795 [Vitis vinifera] 56 6e-06 ref|XP_002268026.1| PREDICTED: cytokinin hydroxylase-like [Vitis... 55 8e-06 ref|XP_002321921.1| hypothetical protein POPTR_0015s13020g [Popu... 55 8e-06 >emb|CBI22718.3| unnamed protein product [Vitis vinifera] Length = 517 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +1 Query: 115 SLAALVFFAFWRLLFSAWISPSRIYQRIRSNGLVGPSPNF 234 ++ + F WR++FS WISP+R+Y+RIR NGL GP P+F Sbjct: 14 AMGLFLLFVLWRVVFSCWISPNRVYRRIRMNGLEGPPPSF 53 >emb|CAN83502.1| hypothetical protein VITISV_025795 [Vitis vinifera] Length = 517 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +1 Query: 115 SLAALVFFAFWRLLFSAWISPSRIYQRIRSNGLVGPSPNF 234 ++ + F WR++FS WISP+R+Y+RIR NGL GP P+F Sbjct: 14 AMGLFLLFVLWRVVFSCWISPNRVYRRIRMNGLEGPPPSF 53 >ref|XP_002268026.1| PREDICTED: cytokinin hydroxylase-like [Vitis vinifera] Length = 503 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/39 (53%), Positives = 29/39 (74%) Frame = +1 Query: 118 LAALVFFAFWRLLFSAWISPSRIYQRIRSNGLVGPSPNF 234 + + F WR++FS WISP+R+Y+RIR NGL GP P+F Sbjct: 1 MGLFLLFVLWRVVFSCWISPNRVYRRIRMNGLEGPPPSF 39 >ref|XP_002321921.1| hypothetical protein POPTR_0015s13020g [Populus trichocarpa] gi|222868917|gb|EEF06048.1| hypothetical protein POPTR_0015s13020g [Populus trichocarpa] Length = 527 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/47 (46%), Positives = 31/47 (65%) Frame = +1 Query: 94 LFSILSVSLAALVFFAFWRLLFSAWISPSRIYQRIRSNGLVGPSPNF 234 LF +L VS+ + WR+LFS WISP+ Y +++ NG GP+PNF Sbjct: 4 LFQVLVVSILTASLYMIWRILFSCWISPAGAYLKLKKNGFGGPTPNF 50