BLASTX nr result
ID: Paeonia24_contig00029954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029954 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263673.2| PREDICTED: putative pentatricopeptide repeat... 51 3e-08 >ref|XP_002263673.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Vitis vinifera] Length = 1088 Score = 50.8 bits (120), Expect(2) = 3e-08 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -1 Query: 175 G*KKKGFNFI*EMQEGDVENDAPTMVTLVNFCANLATLEHGKQ 47 G KK+ FN EM E D+E D TMVT+VN C++L LEHG Q Sbjct: 691 GLKKESFNHFLEMLESDIEYDVLTMVTIVNLCSSLPALEHGDQ 733 Score = 32.7 bits (73), Expect(2) = 3e-08 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = -3 Query: 287 STFVSCVRIDKSIHLFKWVTKINIASWNSIHMG*ANSGVKEK 162 S FV+ R + + +LF + + N A WNSI G AN G+K++ Sbjct: 654 SAFVNSGRANDAKNLFDQMEQRNTALWNSILAGYANKGLKKE 695