BLASTX nr result
ID: Paeonia24_contig00029746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029746 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [A... 56 6e-06 >ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] gi|548845810|gb|ERN05118.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] Length = 425 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -2 Query: 341 LLCTHARGFSVVMENLPHSIINGSFTEITEEFPVIGSLIEELLLTLDK 198 LLCT RGF+++++ LP I N SF +ITEEFPVI ++E+LL+ K Sbjct: 286 LLCTDTRGFNMLIDYLPEPITNNSFQQITEEFPVIRRMLEQLLMNTGK 333