BLASTX nr result
ID: Paeonia24_contig00029715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029715 (604 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily p... 177 2e-42 emb|CBI28722.3| unnamed protein product [Vitis vinifera] 174 2e-41 ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containi... 174 2e-41 gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] 172 7e-41 ref|XP_006355028.1| PREDICTED: pentatricopeptide repeat-containi... 171 2e-40 ref|XP_004237184.1| PREDICTED: pentatricopeptide repeat-containi... 171 2e-40 ref|XP_004505419.1| PREDICTED: pentatricopeptide repeat-containi... 169 6e-40 ref|XP_006602784.1| PREDICTED: pentatricopeptide repeat-containi... 167 2e-39 ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Popu... 166 5e-39 ref|XP_004299875.1| PREDICTED: pentatricopeptide repeat-containi... 166 6e-39 ref|XP_002524751.1| pentatricopeptide repeat-containing protein,... 166 6e-39 ref|XP_007199419.1| hypothetical protein PRUPE_ppa026443mg [Prun... 165 8e-39 ref|XP_007162454.1| hypothetical protein PHAVU_001G153700g [Phas... 164 1e-38 ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citr... 164 2e-38 ref|NP_171809.1| pentatricopeptide repeat-containing protein [Ar... 163 3e-38 ref|XP_004146992.1| PREDICTED: pentatricopeptide repeat-containi... 163 4e-38 ref|NP_001176158.1| Os10g0422566 [Oryza sativa Japonica Group] g... 163 4e-38 ref|XP_006662366.1| PREDICTED: pentatricopeptide repeat-containi... 162 7e-38 ref|XP_006418266.1| hypothetical protein EUTSA_v10006842mg [Eutr... 162 7e-38 ref|XP_006306195.1| hypothetical protein CARUB_v10011829mg [Caps... 161 2e-37 >ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508702800|gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 177 bits (450), Expect = 2e-42 Identities = 84/100 (84%), Positives = 92/100 (92%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK IA + MKFDQELLDS+LYTFVRGGFF+RANEVV +MEKGNMFIDKYKYR Sbjct: 681 VTELWGEMKSIASSTSMKFDQELLDSLLYTFVRGGFFVRANEVVDVMEKGNMFIDKYKYR 740 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGLF 302 TLFLKYHKTLYK +APK QTEAQLK+REA LTFK+WVGL+ Sbjct: 741 TLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFKKWVGLY 780 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 174 bits (440), Expect = 2e-41 Identities = 81/100 (81%), Positives = 91/100 (91%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK A + MKFDQELLD+VLYTFVRGGFF+RANEVV+MME+G MFIDKYKYR Sbjct: 1262 VTELWGEMKSFASSSSMKFDQELLDAVLYTFVRGGFFVRANEVVEMMERGKMFIDKYKYR 1321 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGLF 302 TLFLKYHKTLYKS+ PK+QTEAQ +RR+A LTFK+WVGLF Sbjct: 1322 TLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFKKWVGLF 1361 >ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Vitis vinifera] Length = 784 Score = 174 bits (440), Expect = 2e-41 Identities = 81/100 (81%), Positives = 91/100 (91%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK A + MKFDQELLD+VLYTFVRGGFF+RANEVV+MME+G MFIDKYKYR Sbjct: 685 VTELWGEMKSFASSSSMKFDQELLDAVLYTFVRGGFFVRANEVVEMMERGKMFIDKYKYR 744 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGLF 302 TLFLKYHKTLYKS+ PK+QTEAQ +RR+A LTFK+WVGLF Sbjct: 745 TLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFKKWVGLF 784 >gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] Length = 739 Score = 172 bits (436), Expect = 7e-41 Identities = 82/99 (82%), Positives = 89/99 (89%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK +A + MKFDQELLDSVLYTFVRGGFF RANEVV+MMEKGNMF+DKYKYR Sbjct: 640 VTELWGEMKSLASSTPMKFDQELLDSVLYTFVRGGFFKRANEVVEMMEKGNMFVDKYKYR 699 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTLYK +APK QTEAQL +REA L FK+WVGL Sbjct: 700 TLFLKYHKTLYKGKAPKFQTEAQLSKREAALAFKKWVGL 738 >ref|XP_006355028.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565377103|ref|XP_006355029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 776 Score = 171 bits (432), Expect = 2e-40 Identities = 79/99 (79%), Positives = 90/99 (90%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTE+WGEMK +AF+ MKFDQELLD+VLYTFVRGGFF+RA EVV+MMEKGNMFIDKYKYR Sbjct: 677 VTEIWGEMKSLAFSSGMKFDQELLDAVLYTFVRGGFFVRAIEVVEMMEKGNMFIDKYKYR 736 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTLYK +APK Q+E+Q+K+REA L FKRW GL Sbjct: 737 TLFLKYHKTLYKGKAPKFQSESQMKKREAALNFKRWAGL 775 >ref|XP_004237184.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Solanum lycopersicum] Length = 776 Score = 171 bits (432), Expect = 2e-40 Identities = 80/99 (80%), Positives = 88/99 (88%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK +AF MKFDQELLD+VLYTFVRGGFF+RA EVV+MMEKGNMFIDKYKYR Sbjct: 677 VTELWGEMKSLAFASGMKFDQELLDAVLYTFVRGGFFVRAIEVVQMMEKGNMFIDKYKYR 736 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTLYK +APK Q+E Q+K+REA L FKRW GL Sbjct: 737 TLFLKYHKTLYKGKAPKFQSETQMKKREAALNFKRWAGL 775 >ref|XP_004505419.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Cicer arietinum] gi|502143669|ref|XP_004505420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Cicer arietinum] Length = 784 Score = 169 bits (428), Expect = 6e-40 Identities = 80/99 (80%), Positives = 86/99 (86%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK +A + MKFDQELLDSVLYTFVRGGFF RANEVV MMEKG MFIDKYKYR Sbjct: 685 VTELWGEMKALASSSSMKFDQELLDSVLYTFVRGGFFTRANEVVAMMEKGKMFIDKYKYR 744 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 LFLKYHKTLYK +APK QTE+QL +REA L FKRW+GL Sbjct: 745 MLFLKYHKTLYKGKAPKFQTESQLNKREAALAFKRWIGL 783 >ref|XP_006602784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Glycine max] Length = 784 Score = 167 bits (424), Expect = 2e-39 Identities = 78/99 (78%), Positives = 87/99 (87%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK +A + MKFDQELLDSVLYTFVRGGFF+RANEVV MMEKG MF+DKYKYR Sbjct: 685 VTELWGEMKALASSISMKFDQELLDSVLYTFVRGGFFVRANEVVAMMEKGKMFVDKYKYR 744 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 LFLKYHK+LYK +APK QTE+QL +REA L FKRW+GL Sbjct: 745 MLFLKYHKSLYKGKAPKFQTESQLNKREAALAFKRWIGL 783 >ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] gi|550339593|gb|EEE93781.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] Length = 787 Score = 166 bits (420), Expect = 5e-39 Identities = 79/99 (79%), Positives = 87/99 (87%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK IA MKFDQELLDSVLYTFVRGGFF RANEVV MMEKG MFIDKYKYR Sbjct: 688 VTELWGEMKSIASATSMKFDQELLDSVLYTFVRGGFFSRANEVVDMMEKGKMFIDKYKYR 747 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TL+LKYHKTLYK + PK+QTE+ +K+REA LTFK+W+GL Sbjct: 748 TLYLKYHKTLYKGKTPKIQTESLVKKREAALTFKKWLGL 786 >ref|XP_004299875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 795 Score = 166 bits (419), Expect = 6e-39 Identities = 77/99 (77%), Positives = 87/99 (87%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK +A+ MKFDQELLDSVLYTFVRGGFF RANEV++MMEK MFIDKYKYR Sbjct: 696 VTELWGEMKSLAYNTSMKFDQELLDSVLYTFVRGGFFSRANEVLEMMEKAKMFIDKYKYR 755 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTL+K +APK QTE+QLK+REA L FK W+G+ Sbjct: 756 TLFLKYHKTLHKGKAPKFQTESQLKKREAALAFKNWIGV 794 >ref|XP_002524751.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535935|gb|EEF37594.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 787 Score = 166 bits (419), Expect = 6e-39 Identities = 80/99 (80%), Positives = 87/99 (87%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK IA MKFDQELLDSVLYTFVRGGFF RANEVV MMEK MFIDKYKYR Sbjct: 688 VTELWGEMKSIASATSMKFDQELLDSVLYTFVRGGFFSRANEVVAMMEKVEMFIDKYKYR 747 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTLYK ++PK+QTEAQ ++REA L+FK+WVGL Sbjct: 748 TLFLKYHKTLYKGKSPKIQTEAQARKREAALSFKKWVGL 786 >ref|XP_007199419.1| hypothetical protein PRUPE_ppa026443mg [Prunus persica] gi|462394819|gb|EMJ00618.1| hypothetical protein PRUPE_ppa026443mg [Prunus persica] Length = 789 Score = 165 bits (418), Expect = 8e-39 Identities = 79/99 (79%), Positives = 86/99 (86%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK IA MKFDQELLDSVLYTFVRGGFF RANEVV++MEKG MFIDKYKYR Sbjct: 690 VTELWGEMKSIASATSMKFDQELLDSVLYTFVRGGFFSRANEVVEIMEKGKMFIDKYKYR 749 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYH+T YK +APK QTE+QLK+REA L FK WVG+ Sbjct: 750 TLFLKYHRTSYKGKAPKFQTESQLKKREAALAFKNWVGV 788 >ref|XP_007162454.1| hypothetical protein PHAVU_001G153700g [Phaseolus vulgaris] gi|561035918|gb|ESW34448.1| hypothetical protein PHAVU_001G153700g [Phaseolus vulgaris] Length = 785 Score = 164 bits (416), Expect = 1e-38 Identities = 78/99 (78%), Positives = 85/99 (85%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK A + M FDQELLDSVLYTFVRGGFF RANEVV MMEKGNMF+DKYKYR Sbjct: 685 VTELWGEMKAHASSVSMTFDQELLDSVLYTFVRGGFFARANEVVTMMEKGNMFVDKYKYR 744 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 LFLKYHK+LYK +APK QTE+QL +REA L FKRW+GL Sbjct: 745 MLFLKYHKSLYKGKAPKFQTESQLSKREAALAFKRWIGL 783 >ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] gi|568852030|ref|XP_006479684.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Citrus sinensis] gi|568852032|ref|XP_006479685.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Citrus sinensis] gi|557546294|gb|ESR57272.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] Length = 784 Score = 164 bits (414), Expect = 2e-38 Identities = 78/99 (78%), Positives = 85/99 (85%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK A + M FD+ELLDSVLYTFVRGGFF RANEVV MME+G MFIDKYKYR Sbjct: 685 VTELWGEMKSFASSTSMNFDEELLDSVLYTFVRGGFFARANEVVAMMEEGKMFIDKYKYR 744 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYHKTLYK + PK QTEAQLK+REA L FK+W+GL Sbjct: 745 TLFLKYHKTLYKGKTPKFQTEAQLKKREAALGFKKWLGL 783 >ref|NP_171809.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200246|sp|Q9SA60.1|PPR6_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g03100, mitochondrial; Flags: Precursor gi|4587568|gb|AAD25799.1|AC006550_7 Contains PF|00637 Clathrin 7-fold repeat. EST gb|AA721862 comes from this gene [Arabidopsis thaliana] gi|44917465|gb|AAS49057.1| At1g03100 [Arabidopsis thaliana] gi|332189408|gb|AEE27529.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 793 Score = 163 bits (413), Expect = 3e-38 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 1/100 (1%) Frame = +3 Query: 3 VTELWGEMKVIAF-TKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKY 179 VTELWGEMK IA T MKFDQELLD+VLYTFVRGGFF RANEVV+MMEK NMF+DKYKY Sbjct: 693 VTELWGEMKSIAAATSSMKFDQELLDAVLYTFVRGGFFSRANEVVEMMEKKNMFVDKYKY 752 Query: 180 RTLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 R LFLKYHKT YK +APK+Q+E+QLK+REAGL FK+W+GL Sbjct: 753 RMLFLKYHKTAYKGKAPKVQSESQLKKREAGLVFKKWLGL 792 >ref|XP_004146992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Cucumis sativus] gi|449503826|ref|XP_004162196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Cucumis sativus] Length = 796 Score = 163 bits (412), Expect = 4e-38 Identities = 78/99 (78%), Positives = 86/99 (86%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VTELWGEMK IA +KFDQELLDSVLYTFVRGGFF RANEVV++MEK MFIDKYKYR Sbjct: 697 VTELWGEMKSIASASFLKFDQELLDSVLYTFVRGGFFARANEVVEVMEKDKMFIDKYKYR 756 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 TLFLKYH+TLYK +APK QTEAQL++RE L FK+WVGL Sbjct: 757 TLFLKYHRTLYKGKAPKFQTEAQLRKRETTLAFKKWVGL 795 >ref|NP_001176158.1| Os10g0422566 [Oryza sativa Japonica Group] gi|255679411|dbj|BAH94886.1| Os10g0422566, partial [Oryza sativa Japonica Group] Length = 788 Score = 163 bits (412), Expect = 4e-38 Identities = 75/99 (75%), Positives = 89/99 (89%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VT+LWGEMKV+A + M FDQELLDS+LY FVRGGFF+RA EV++MMEKG MFIDKYKY+ Sbjct: 689 VTDLWGEMKVLATSSSMNFDQELLDSLLYCFVRGGFFLRAMEVIEMMEKGKMFIDKYKYK 748 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 +L+LKYH+TLYK +APK+QTEAQLKRREA L FKRW+GL Sbjct: 749 SLWLKYHRTLYKGKAPKVQTEAQLKRREAALHFKRWIGL 787 >ref|XP_006662366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Oryza brachyantha] Length = 825 Score = 162 bits (410), Expect = 7e-38 Identities = 74/99 (74%), Positives = 90/99 (90%) Frame = +3 Query: 3 VTELWGEMKVIAFTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKYR 182 VT+LWGEMKV+A + MKFDQELLDS+LY FVRGGFF+RA EV++MMEKG +FIDKYKY+ Sbjct: 726 VTDLWGEMKVLANSSSMKFDQELLDSLLYCFVRGGFFLRAMEVIEMMEKGKLFIDKYKYK 785 Query: 183 TLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 +L+LKYH+TLYK +APK+QTEAQ+KRREA L FKRW+GL Sbjct: 786 SLWLKYHRTLYKGKAPKVQTEAQVKRREAALHFKRWIGL 824 >ref|XP_006418266.1| hypothetical protein EUTSA_v10006842mg [Eutrema salsugineum] gi|557096037|gb|ESQ36619.1| hypothetical protein EUTSA_v10006842mg [Eutrema salsugineum] Length = 791 Score = 162 bits (410), Expect = 7e-38 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 1/100 (1%) Frame = +3 Query: 3 VTELWGEMKVIA-FTKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKY 179 VTELWGEMK IA T M+FDQELLD+VLYTFVRGGFF RANEVV+MMEK NMF+DKYKY Sbjct: 691 VTELWGEMKSIAGATSSMRFDQELLDAVLYTFVRGGFFSRANEVVEMMEKDNMFVDKYKY 750 Query: 180 RTLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 R LFLKYHKT YK +APK+Q+E+QL++RE+GLTFK+W+GL Sbjct: 751 RMLFLKYHKTAYKGKAPKVQSESQLRKRESGLTFKKWLGL 790 >ref|XP_006306195.1| hypothetical protein CARUB_v10011829mg [Capsella rubella] gi|482574906|gb|EOA39093.1| hypothetical protein CARUB_v10011829mg [Capsella rubella] Length = 794 Score = 161 bits (407), Expect = 2e-37 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 1/100 (1%) Frame = +3 Query: 3 VTELWGEMKVIAF-TKKMKFDQELLDSVLYTFVRGGFFIRANEVVKMMEKGNMFIDKYKY 179 VTELWGEMK IA T M+FDQELLD+VLYTFVRGGFF RANEVV+MMEK NMF+DKYKY Sbjct: 694 VTELWGEMKSIAAATSVMRFDQELLDAVLYTFVRGGFFSRANEVVEMMEKKNMFVDKYKY 753 Query: 180 RTLFLKYHKTLYKSRAPKMQTEAQLKRREAGLTFKRWVGL 299 R LFLKYHKT YK +APK+Q+E+QLK+REAGL FK+W+GL Sbjct: 754 RMLFLKYHKTAYKGKAPKVQSESQLKKREAGLIFKKWLGL 793