BLASTX nr result
ID: Paeonia24_contig00029628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029628 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 59 5e-07 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 253 MEYMTKVEYWRISIDRSCHIHTGPSRTSNCFDL 351 MEYMTKVE W ISIDRSCHI GPS+TSNCFDL Sbjct: 1 MEYMTKVECWSISIDRSCHI--GPSQTSNCFDL 31