BLASTX nr result
ID: Paeonia24_contig00029266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029266 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 59 7e-07 ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 59 7e-07 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 59 7e-07 ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 59 7e-07 ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 58 2e-06 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 57 3e-06 ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, part... 55 8e-06 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL ++Q Q + Sbjct: 765 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVLGNTISQSQGA 815 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL ++Q Q + Sbjct: 232 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVLGNTISQSQGA 282 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL ++Q Q + Sbjct: 239 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVLGNTISQSQGA 289 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL ++Q Q + Sbjct: 381 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVLGNTISQSQGA 431 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L SR VL ++Q Q + Sbjct: 475 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLVSRLREVLGNTISQSQGA 525 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV DY P S VTSLYK+I K L+S VL ++Q Q + Sbjct: 788 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASSLREVLGNTISQSQGA 838 >ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] gi|462398481|gb|EMJ04149.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] Length = 1162 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 170 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVLKFIVAQEQSS 18 ICLIPKK NS KV D P S VTSLYK+I K L+SR VL ++Q Q + Sbjct: 483 ICLIPKKANSVKVTDNRPISLVTSLYKVISKVLASRLREVLGNTISQSQGA 533