BLASTX nr result
ID: Paeonia24_contig00029162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029162 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322982.1| hypothetical protein POPTR_0016s12390g [Popu... 62 1e-07 ref|XP_002528089.1| symplekin, putative [Ricinus communis] gi|22... 58 1e-06 >ref|XP_002322982.1| hypothetical protein POPTR_0016s12390g [Populus trichocarpa] gi|222867612|gb|EEF04743.1| hypothetical protein POPTR_0016s12390g [Populus trichocarpa] Length = 1411 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 367 SPENSDKNVELESGDRVTRSLRTVWSLILMRHPIREASLKIAL 239 SP N DK EL+SGDRVT+ L TVWSLIL+R PIRE+ LKIAL Sbjct: 900 SPGNIDKAEELQSGDRVTQGLSTVWSLILLRPPIRESCLKIAL 942 >ref|XP_002528089.1| symplekin, putative [Ricinus communis] gi|223532478|gb|EEF34268.1| symplekin, putative [Ricinus communis] Length = 1341 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -1 Query: 367 SPENSDK-NVELESGDRVTRSLRTVWSLILMRHPIREASLKIAL 239 SPEN DK + +SGDRVT+ L TVWSLIL+R PIRE LKIAL Sbjct: 846 SPENGDKAEKDFQSGDRVTQGLSTVWSLILLRPPIREVCLKIAL 889