BLASTX nr result
ID: Paeonia24_contig00029126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00029126 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533676.1| pentatricopeptide repeat-containing protein,... 54 1e-10 ref|XP_002274344.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_007022726.1| Pentatricopeptide repeat-containing protein,... 64 3e-08 >ref|XP_002533676.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526427|gb|EEF28706.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 726 Score = 53.9 bits (128), Expect(2) = 1e-10 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = +1 Query: 1 IVSNEF-ETVSIAS-KLISLYTHFDDLKSAVLILKAVRVPHTIVWNSIMKSHVDLGFYGV 174 +VS F E++S S KLIS Y+ F+DL+SA+ + ++ P+T+ WN IM++H+D G Sbjct: 52 LVSTGFNESISFPSTKLISFYSKFNDLESAISVFSLLQEPNTLSWNLIMRTHLDFGLVTE 111 Query: 175 AFSLY 189 A LY Sbjct: 112 ALLLY 116 Score = 37.7 bits (86), Expect(2) = 1e-10 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +3 Query: 195 MRELDVKHDSFTFPIINRAISSLHCNARCGEM 290 MRE VK D+FTFP INRA+ SL + G+M Sbjct: 119 MRESGVKTDAFTFPTINRAVMSLKSDVLLGKM 150 >ref|XP_002274344.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 739 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = +1 Query: 1 IVSNEFETVSIASKLISLYTHFDDLKSAVLILKAVRVPHTIVWNSIMKSHVDLGFYGVAF 180 IVS+ F+ +S+ASKLI+LY+ +D +SA I + P+T++WNSI+KSHVD G +G A Sbjct: 75 IVSSGFQPLSVASKLITLYSQLNDFRSAFSICNSFEEPNTVIWNSIIKSHVDSGLFGYAL 134 Query: 181 SLYG 192 YG Sbjct: 135 LQYG 138 >ref|XP_007022726.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508722354|gb|EOY14251.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 682 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +1 Query: 16 FETVSIASKLISLYTHFDDLKSAVLILKAVRVPHTIVWNSIMKSHVDLGFYGVAFSLY 189 F S AS+LIS Y HF+DL++AVL++K+++ TI WN I+KSHVD G+ A LY Sbjct: 24 FLPTSWASRLISFYAHFNDLETAVLVVKSLKQADTITWNLIIKSHVDFGYIEKALFLY 81