BLASTX nr result
ID: Paeonia24_contig00027759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00027759 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 49 8e-07 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 49 8e-07 ref|XP_001852902.1| GLP_748_1200_211 [Culex quinquefasciatus] gi... 53 2e-06 gb|EMD30442.1| hypothetical protein CERSUDRAFT_163840, partial [... 53 3e-06 ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago ... 55 6e-06 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 53 7e-06 ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [... 53 7e-06 ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago ... 53 7e-06 ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago ... 53 7e-06 ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago ... 53 7e-06 ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago ... 53 7e-06 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 48.9 bits (115), Expect(2) = 8e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +2 Query: 2 DRDSGNLINPFMCVTN*MMRHLATIRDS 85 DRDSGNL+NPFM VTN M RHLAT+R+S Sbjct: 322 DRDSGNLVNPFMRVTNQMTRHLATLRES 349 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 124 TLTFRALGRNHIALT 168 TLTFRALGRNHI T Sbjct: 364 TLTFRALGRNHIVST 378 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 48.9 bits (115), Expect(2) = 8e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +2 Query: 2 DRDSGNLINPFMCVTN*MMRHLATIRDS 85 DRDSGNL+NPFM VTN M RHLAT+R+S Sbjct: 322 DRDSGNLVNPFMRVTNQMTRHLATLRES 349 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 124 TLTFRALGRNHIALT 168 TLTFRALGRNHI T Sbjct: 364 TLTFRALGRNHIVST 378 >ref|XP_001852902.1| GLP_748_1200_211 [Culex quinquefasciatus] gi|167870569|gb|EDS33952.1| GLP_748_1200_211 [Culex quinquefasciatus] Length = 51 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVN 167 IVTPAVCPR +EF+H DI S GQKSHCVN Sbjct: 13 IVTPAVCPRLLEFLHVDIQSTGQKSHCVN 41 Score = 24.3 bits (51), Expect(2) = 2e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 49 LDDEAFGYHKR 81 LDDEAFGY KR Sbjct: 1 LDDEAFGYLKR 11 >gb|EMD30442.1| hypothetical protein CERSUDRAFT_163840, partial [Ceriporiopsis subvermispora B] gi|449540873|gb|EMD31861.1| hypothetical protein CERSUDRAFT_59500, partial [Ceriporiopsis subvermispora B] gi|521719763|gb|EPQ50235.1| hypothetical protein GLOTRDRAFT_50878, partial [Gloeophyllum trabeum ATCC 11539] Length = 64 Score = 52.8 bits (125), Expect(2) = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVN 167 IVTPAV PR VEF+HFDI S GQKSHCVN Sbjct: 13 IVTPAVYPRLVEFLHFDIQSTGQKSHCVN 41 Score = 24.3 bits (51), Expect(2) = 3e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 49 LDDEAFGYHKR 81 LDDEAFGY KR Sbjct: 1 LDDEAFGYLKR 11 >ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula] gi|355515729|gb|AES97352.1| hypothetical protein MTR_5g051130 [Medicago truncatula] Length = 1337 Score = 55.1 bits (131), Expect(2) = 6e-06 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVN-GRIPLVCTNYELTL*HSRKAPKDLFPVHPP 257 IVTPAV PR VEF+HFDI S GQKSHCVN R L C+ + +K P FPV PP Sbjct: 211 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIRRDHLDCS---MPGEEDQKVP---FPVRPP 264 Score = 20.4 bits (41), Expect(2) = 6e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 203 RQGQWES 209 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 814 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 844 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 849 PKGPVPSPSP 858 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 806 RQGQWES 812 >ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] gi|355504386|gb|AES85589.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] Length = 1458 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 333 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 363 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 368 PKGPVPSPSP 377 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 325 RQGQWES 331 >ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago truncatula] gi|355515730|gb|AES97353.1| hypothetical protein MTR_5g051140 [Medicago truncatula] Length = 1186 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 209 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 239 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 244 PKGPVPSPSP 253 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 201 RQGQWES 207 >ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago truncatula] gi|355515719|gb|AES97342.1| hypothetical protein MTR_5g051010 [Medicago truncatula] Length = 1153 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 303 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 333 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 534 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 564 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 338 PKGPVPSPSP 347 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 569 PKGPVPSPSP 578 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 295 RQGQWES 301 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 55 DEAFGYHKR 81 DEAFGY KR Sbjct: 524 DEAFGYLKR 532 >ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula] gi|355515717|gb|AES97340.1| hypothetical protein MTR_5g050970 [Medicago truncatula] Length = 1065 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 305 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 335 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 340 PKGPVPSPSP 349 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 297 RQGQWES 303 >ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula] gi|355515721|gb|AES97344.1| hypothetical protein MTR_5g051030 [Medicago truncatula] Length = 795 Score = 53.1 bits (126), Expect(3) = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 81 IVTPAVCPRFVEFIHFDI*SPGQKSHCVNGR 173 IVTPAV PR VEF+HFDI S GQKSHCVN R Sbjct: 176 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNIR 206 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 227 PKRSVPSPSP 256 PK VPSPSP Sbjct: 211 PKGPVPSPSP 220 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 RQGQWES 21 RQGQWES Sbjct: 168 RQGQWES 174