BLASTX nr result
ID: Paeonia24_contig00027752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00027752 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citr... 76 4e-12 ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phas... 74 2e-11 ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [... 74 2e-11 ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prun... 74 2e-11 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] 73 4e-11 ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phas... 73 5e-11 ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [... 73 5e-11 ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [... 73 5e-11 ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]... 73 5e-11 ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prun... 72 8e-11 gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] 72 8e-11 ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloropla... 72 8e-11 ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloropla... 72 8e-11 gb|AFK38605.1| unknown [Lotus japonicus] 72 1e-10 gb|ADY38579.1| allene oxide cyclase [Camellia sinensis] 71 1e-10 gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum] 71 2e-10 gb|AGU41846.1| allene oxide cyclase [Triticum aestivum] 71 2e-10 emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vul... 71 2e-10 dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare] 71 2e-10 ref|XP_002524412.1| Allene oxide cyclase 3, chloroplast precurso... 70 2e-10 >ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] gi|568861856|ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus sinensis] gi|557539928|gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] Length = 257 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYE+TYLA+TGGSG+F+GVYGQVKLH I++ K YTFY KG+ L EL+V+ Sbjct: 177 TYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPYKLFYTFYLKGVADLPQELLVK 229 >ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris] gi|561012462|gb|ESW11323.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris] Length = 250 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYE++YLA+TGGSG+F+GV GQVKLH I+Y K LYTFY KGI L EL+V+ Sbjct: 170 TYEDSYLAVTGGSGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVK 222 >ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [Glycine max] gi|332739622|gb|AEE99200.1| allene oxide cyclase 5 [Glycine max] Length = 257 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYE++YLA+TGGSG+F+GV GQVKLH I+Y K LYTFY KGI L EL+V+ Sbjct: 177 TYEDSYLAVTGGSGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVK 229 >ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] gi|462411191|gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] Length = 184 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMEL 14 TYE+TYLA+TGGSG+F+GVYGQVKLH I++ K LYTFY KGI L EL Sbjct: 103 TYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPFKILYTFYLKGIEDLPEEL 152 >gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] Length = 247 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYE+TYLA+TGGSG+F+GVYGQVKL II+ K YTFY KGI L EL+V+ Sbjct: 167 TYEDTYLAVTGGSGIFEGVYGQVKLQQIIFPFKLFYTFYLKGIKDLPKELLVK 219 >ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris] gi|561025064|gb|ESW23749.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris] Length = 253 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYE TYLA+TGGSG+F+GVYGQVKLH +++ K YTFY KGI L EL+ Sbjct: 173 TYENTYLAVTGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGIKDLPQELL 223 >ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [Glycine max] gi|332739624|gb|AEE99201.1| allene oxide cyclase 6 [Glycine max] Length = 255 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYE+TYLA+TGGSG+F+GV GQVKL I+Y K LYTFY KGI L EL+V+ Sbjct: 175 TYEDTYLAVTGGSGIFEGVKGQVKLRQIVYPFKILYTFYLKGIKDLPQELLVK 227 >ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max] gi|332739620|gb|AEE99199.1| allene oxide cyclase 4 [Glycine max] Length = 253 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYE+TYLA+TGGSG+F+G YGQVKLH I++ K YTFY KGI L EL+ Sbjct: 173 TYEDTYLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELL 223 >ref|NP_001240200.1| membrane primary amine oxidase [Glycine max] gi|332739618|gb|AEE99198.1| allene oxide cyclase 3 [Glycine max] Length = 257 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYE+TYLA+TGGSG+F+G YGQVKLH I++ K YTFY KGI L EL+ Sbjct: 177 TYEDTYLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELL 227 >ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] gi|462420656|gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] Length = 251 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMEL 14 TYE+TYLA+TGGSG+F+GVYGQVKL I++ +K YTFY KGI L +EL Sbjct: 170 TYEDTYLAVTGGSGIFEGVYGQVKLKQIVFPIKLFYTFYLKGISDLPVEL 219 >gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] Length = 238 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ Sbjct: 158 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 208 >ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 256 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ Sbjct: 176 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 226 >ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 1 [Brachypodium distachyon] Length = 243 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ Sbjct: 163 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELL 213 >gb|AFK38605.1| unknown [Lotus japonicus] Length = 248 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVE 5 TYEE+YLA+TGGSG+F+GVYGQVKL+ I++ K YTFY KGI L EL+ + Sbjct: 168 TYEESYLAVTGGSGIFEGVYGQVKLNQIVFPFKLFYTFYLKGIKDLPQELLAK 220 >gb|ADY38579.1| allene oxide cyclase [Camellia sinensis] Length = 245 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYE+T LA+TGGSG+F+GVYGQVKLH II+ K YTFY KGI L +EL+ Sbjct: 165 TYEDTCLAVTGGSGIFEGVYGQVKLHQIIFPFKLFYTFYLKGIPDLPVELL 215 >gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum] Length = 239 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELL 208 >gb|AGU41846.1| allene oxide cyclase [Triticum aestivum] Length = 238 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELL 208 >emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vulgare] Length = 238 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELL 208 >dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 238 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELL 208 >ref|XP_002524412.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus communis] gi|223536373|gb|EEF38023.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus communis] Length = 259 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -1 Query: 163 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELI 11 TY++TYLA+TGG+G+F+GVYGQVKLH I++ K YTFY KGI L EL+ Sbjct: 179 TYDDTYLAVTGGTGIFEGVYGQVKLHQIVFPYKLFYTFYLKGIPDLPDELL 229