BLASTX nr result
ID: Paeonia24_contig00026956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026956 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313034.2| hypothetical protein POPTR_0009s12200g [Popu... 75 1e-11 ref|XP_007200293.1| hypothetical protein PRUPE_ppa004093mg [Prun... 75 1e-11 emb|CBI37680.3| unnamed protein product [Vitis vinifera] 73 5e-11 ref|XP_002280254.1| PREDICTED: bifunctional dihydrofolate reduct... 73 5e-11 ref|XP_006409445.1| hypothetical protein EUTSA_v10022646mg [Eutr... 72 6e-11 ref|XP_006384511.1| hypothetical protein POPTR_0004s16470g [Popu... 72 6e-11 ref|XP_004507474.1| PREDICTED: bifunctional dihydrofolate reduct... 72 1e-10 ref|XP_004507472.1| PREDICTED: bifunctional dihydrofolate reduct... 72 1e-10 ref|XP_004289633.1| PREDICTED: bifunctional dihydrofolate reduct... 72 1e-10 ref|XP_003541010.1| PREDICTED: bifunctional dihydrofolate reduct... 72 1e-10 ref|XP_002512938.1| bifunctional dihydrofolate reductase-thymidy... 72 1e-10 ref|XP_003606965.1| Bifunctional dihydrofolate reductase-thymidy... 72 1e-10 ref|XP_006423346.1| hypothetical protein CICLE_v10028191mg [Citr... 71 1e-10 ref|XP_006412210.1| hypothetical protein EUTSA_v10024973mg [Eutr... 71 1e-10 ref|XP_006487231.1| PREDICTED: bifunctional dihydrofolate reduct... 70 3e-10 ref|XP_007131806.1| hypothetical protein PHAVU_011G043000g [Phas... 69 5e-10 ref|XP_004979277.1| PREDICTED: bifunctional dihydrofolate reduct... 69 5e-10 ref|XP_004979276.1| PREDICTED: bifunctional dihydrofolate reduct... 69 5e-10 ref|XP_004979275.1| PREDICTED: bifunctional dihydrofolate reduct... 69 5e-10 ref|XP_004958499.1| PREDICTED: bifunctional dihydrofolate reduct... 69 5e-10 >ref|XP_002313034.2| hypothetical protein POPTR_0009s12200g [Populus trichocarpa] gi|550331572|gb|EEE86989.2| hypothetical protein POPTR_0009s12200g [Populus trichocarpa] Length = 528 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVAADFELIGYDPHQKIEMKMAV Sbjct: 491 FPILKINSEKKDIDSFVAADFELIGYDPHQKIEMKMAV 528 >ref|XP_007200293.1| hypothetical protein PRUPE_ppa004093mg [Prunus persica] gi|462395693|gb|EMJ01492.1| hypothetical protein PRUPE_ppa004093mg [Prunus persica] Length = 530 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVAADFELIGYDPHQKIEMKMAV Sbjct: 493 FPILKINPEKKNIDSFVAADFELIGYDPHQKIEMKMAV 530 >emb|CBI37680.3| unnamed protein product [Vitis vinifera] Length = 608 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN +KK IDSFVAADF+LIGYDPHQKIEMKMAV Sbjct: 571 FPILKINPQKKNIDSFVAADFQLIGYDPHQKIEMKMAV 608 >ref|XP_002280254.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Vitis vinifera] Length = 524 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN +KK IDSFVAADF+LIGYDPHQKIEMKMAV Sbjct: 487 FPILKINPQKKNIDSFVAADFQLIGYDPHQKIEMKMAV 524 >ref|XP_006409445.1| hypothetical protein EUTSA_v10022646mg [Eutrema salsugineum] gi|557110607|gb|ESQ50898.1| hypothetical protein EUTSA_v10022646mg [Eutrema salsugineum] Length = 517 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FP+LKI QEKK IDSFVAADFELIGYDPH+KIEMKMAV Sbjct: 480 FPVLKIKQEKKHIDSFVAADFELIGYDPHKKIEMKMAV 517 >ref|XP_006384511.1| hypothetical protein POPTR_0004s16470g [Populus trichocarpa] gi|566166865|ref|XP_002306118.2| hypothetical protein POPTR_0004s16470g [Populus trichocarpa] gi|566166867|ref|XP_006384512.1| dihydrofolate reductase-thymidylate synthase family protein [Populus trichocarpa] gi|550341164|gb|ERP62308.1| hypothetical protein POPTR_0004s16470g [Populus trichocarpa] gi|550341165|gb|EEE86629.2| hypothetical protein POPTR_0004s16470g [Populus trichocarpa] gi|550341166|gb|ERP62309.1| dihydrofolate reductase-thymidylate synthase family protein [Populus trichocarpa] Length = 528 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK ID+FVAADF+LIGYDPHQKIEMKMAV Sbjct: 491 FPILKINSEKKDIDTFVAADFKLIGYDPHQKIEMKMAV 528 >ref|XP_004507474.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X3 [Cicer arietinum] Length = 530 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVA DF+LIGYDPHQKIEMKMAV Sbjct: 493 FPILKINPEKKDIDSFVATDFKLIGYDPHQKIEMKMAV 530 >ref|XP_004507472.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Cicer arietinum] gi|502149300|ref|XP_004507473.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X2 [Cicer arietinum] Length = 554 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVA DF+LIGYDPHQKIEMKMAV Sbjct: 517 FPILKINPEKKDIDSFVATDFKLIGYDPHQKIEMKMAV 554 >ref|XP_004289633.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Fragaria vesca subsp. vesca] Length = 528 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVAADFEL GYDPH+KIEMKMAV Sbjct: 491 FPILKINPEKKNIDSFVAADFELSGYDPHEKIEMKMAV 528 >ref|XP_003541010.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Glycine max] Length = 530 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN +KK IDSFVAADF+LIGYDPHQKIEMKMAV Sbjct: 493 FPILKINPKKKDIDSFVAADFKLIGYDPHQKIEMKMAV 530 >ref|XP_002512938.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] gi|223547949|gb|EEF49441.1| bifunctional dihydrofolate reductase-thymidylate synthase, putative [Ricinus communis] Length = 528 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVAADF+LIGYDPH KIEMKMAV Sbjct: 491 FPILKINPEKKNIDSFVAADFKLIGYDPHHKIEMKMAV 528 >ref|XP_003606965.1| Bifunctional dihydrofolate reductase-thymidylate synthase [Medicago truncatula] gi|355508020|gb|AES89162.1| Bifunctional dihydrofolate reductase-thymidylate synthase [Medicago truncatula] Length = 528 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN +KK IDSFVAADF+LIGYDPHQKIEMKMAV Sbjct: 491 FPILKINPKKKDIDSFVAADFKLIGYDPHQKIEMKMAV 528 >ref|XP_006423346.1| hypothetical protein CICLE_v10028191mg [Citrus clementina] gi|567861386|ref|XP_006423347.1| hypothetical protein CICLE_v10028191mg [Citrus clementina] gi|557525280|gb|ESR36586.1| hypothetical protein CICLE_v10028191mg [Citrus clementina] gi|557525281|gb|ESR36587.1| hypothetical protein CICLE_v10028191mg [Citrus clementina] Length = 527 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFVA DF+LIGYDPHQKIEMKMAV Sbjct: 490 FPILKINPEKKDIDSFVAEDFKLIGYDPHQKIEMKMAV 527 >ref|XP_006412210.1| hypothetical protein EUTSA_v10024973mg [Eutrema salsugineum] gi|557113380|gb|ESQ53663.1| hypothetical protein EUTSA_v10024973mg [Eutrema salsugineum] Length = 503 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FP+LKIN EKK IDSFVAADFELIGYDPH+KI+MKMAV Sbjct: 466 FPVLKINPEKKHIDSFVAADFELIGYDPHKKIDMKMAV 503 >ref|XP_006487231.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Citrus sinensis] gi|568867829|ref|XP_006487232.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X2 [Citrus sinensis] gi|568867831|ref|XP_006487233.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X3 [Citrus sinensis] gi|568867833|ref|XP_006487234.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X4 [Citrus sinensis] gi|568867835|ref|XP_006487235.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X5 [Citrus sinensis] gi|568867837|ref|XP_006487236.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X6 [Citrus sinensis] gi|568867839|ref|XP_006487237.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X7 [Citrus sinensis] Length = 527 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN EKK IDSFV+ DF+LIGYDPHQKIEMKMAV Sbjct: 490 FPILKINPEKKDIDSFVSEDFKLIGYDPHQKIEMKMAV 527 >ref|XP_007131806.1| hypothetical protein PHAVU_011G043000g [Phaseolus vulgaris] gi|593140048|ref|XP_007131807.1| hypothetical protein PHAVU_011G043000g [Phaseolus vulgaris] gi|561004806|gb|ESW03800.1| hypothetical protein PHAVU_011G043000g [Phaseolus vulgaris] gi|561004807|gb|ESW03801.1| hypothetical protein PHAVU_011G043000g [Phaseolus vulgaris] Length = 540 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN +KK IDSFVAAD +LIGYDPHQKIEMKMAV Sbjct: 503 FPILKINPKKKDIDSFVAADLKLIGYDPHQKIEMKMAV 540 >ref|XP_004979277.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X3 [Setaria italica] Length = 521 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN KK IDSFVA+DF+L+GYDPHQKIEMKMA+ Sbjct: 484 FPILKINPSKKDIDSFVASDFKLVGYDPHQKIEMKMAI 521 >ref|XP_004979276.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X2 [Setaria italica] Length = 580 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN KK IDSFVA+DF+L+GYDPHQKIEMKMA+ Sbjct: 543 FPILKINPSKKDIDSFVASDFKLVGYDPHQKIEMKMAI 580 >ref|XP_004979275.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Setaria italica] Length = 582 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN KK IDSFVA+DF+L+GYDPHQKIEMKMA+ Sbjct: 545 FPILKINPSKKDIDSFVASDFKLVGYDPHQKIEMKMAI 582 >ref|XP_004958499.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Setaria italica] Length = 521 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 FPILKINQEKKGIDSFVAADFELIGYDPHQKIEMKMAV 114 FPILKIN KK IDSFVA+DF+L+GYDPHQKIEMKMA+ Sbjct: 484 FPILKINPSKKDIDSFVASDFKLVGYDPHQKIEMKMAI 521