BLASTX nr result
ID: Paeonia24_contig00026140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026140 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515928.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_006385495.1| hypothetical protein POPTR_0003s05980g [Popu... 55 1e-05 >ref|XP_002515928.1| conserved hypothetical protein [Ricinus communis] gi|223544833|gb|EEF46348.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Frame = +3 Query: 9 AGNTSRSILATLFILAMVVTPMLPCEAVRFSERDSV---EPTINCTCACVQAP-----CD 164 A ++ +S L TLFI AMV++PM+P EA R ++RD + EP C C P CD Sbjct: 2 ASSSLKSFLVTLFIFAMVLSPMIPSEAARMNQRDLLQTNEPIFCPACVCCSPPPPGQCCD 61 Query: 165 CCDYPDPTEPATGSP 209 CC P P TGSP Sbjct: 62 CCATP---VPDTGSP 73 >ref|XP_006385495.1| hypothetical protein POPTR_0003s05980g [Populus trichocarpa] gi|550342510|gb|ERP63292.1| hypothetical protein POPTR_0003s05980g [Populus trichocarpa] Length = 75 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 7/73 (9%) Frame = +3 Query: 12 GNTSRSILATLFILAMVVTPMLP-CEAVRFSERDSVEPTINC-TCACVQAP-----CDCC 170 GN+ +SIL TLFI AMV++P+LP EA R + R C C C P C CC Sbjct: 3 GNSLKSILVTLFIFAMVLSPILPSAEAGRLNHRGLQSGRPICPACVCCSPPPPGSCCPCC 62 Query: 171 DYPDPTEPATGSP 209 P TE TGSP Sbjct: 63 STPIETESTTGSP 75