BLASTX nr result
ID: Paeonia24_contig00025487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00025487 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277733.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 emb|CAN71816.1| hypothetical protein VITISV_023421 [Vitis vinifera] 60 4e-07 >ref|XP_002277733.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, mitochondrial [Vitis vinifera] gi|296089781|emb|CBI39600.3| unnamed protein product [Vitis vinifera] Length = 498 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -1 Query: 244 EETISMFLRCFEEEKDTDSAEKFFEIMKKIDRLDMKIFETV---SIAAGK 104 EETI+MFL FEE KD DSAEKF E M+KI RLD KI++++ IAAGK Sbjct: 419 EETITMFLEYFEEVKDVDSAEKFCETMRKISRLDSKIYDSLLRTYIAAGK 468 >emb|CAN71816.1| hypothetical protein VITISV_023421 [Vitis vinifera] Length = 494 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -1 Query: 244 EETISMFLRCFEEEKDTDSAEKFFEIMKKIDRLDMKIFETV---SIAAGK 104 EETI+MFL FEE KD DSAEKF E M+KI RLD KI++++ IAAGK Sbjct: 415 EETITMFLEYFEEVKDVDSAEKFCETMRKISRLDSKIYDSLLRTYIAAGK 464