BLASTX nr result
ID: Paeonia24_contig00025159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00025159 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 57 3e-06 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +2 Query: 170 QEERKELVFKVDFEKAFDRVEWSFVEHVLEDKGFGTR 280 +++RK LVFK+DFEKA+D VEW+FV+ VL+ KGFG R Sbjct: 454 KQKRKGLVFKIDFEKAYDHVEWNFVDDVLDRKGFGFR 490