BLASTX nr result
ID: Paeonia24_contig00024959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00024959 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66898.1| hypothetical protein L484_019536 [Morus notabilis] 57 3e-06 >gb|EXB66898.1| hypothetical protein L484_019536 [Morus notabilis] Length = 110 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/68 (47%), Positives = 38/68 (55%) Frame = -3 Query: 293 LNKEPNKNATKVTPQAMANDGEFARAEEVGLGAGASAPCAAPMRARTVMQRATRWNSDAV 114 L +EP AT+ +A NDGE A A E GLGAG SA APM RTV A R ++A Sbjct: 32 LREEPKTRATRAAKKAERNDGEIAAAGEAGLGAGDSAAWVAPMMERTVKITAARATTEAC 91 Query: 113 DAVIAISR 90 + IA R Sbjct: 92 ERAIAECR 99