BLASTX nr result
ID: Paeonia24_contig00024940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00024940 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477079.1| PREDICTED: zinc finger protein 281-like [Cit... 71 2e-10 ref|XP_006440168.1| hypothetical protein CICLE_v10023888mg [Citr... 71 2e-10 ref|XP_003635079.1| PREDICTED: uncharacterized protein LOC100852... 62 6e-08 ref|XP_006359212.1| PREDICTED: uncharacterized protein LOC102590... 60 2e-07 ref|XP_004245826.1| PREDICTED: uncharacterized protein LOC101248... 60 2e-07 ref|XP_002524361.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 >ref|XP_006477079.1| PREDICTED: zinc finger protein 281-like [Citrus sinensis] Length = 193 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%) Frame = +2 Query: 89 VQSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKRK-KNRRNSGSTANKMKAVMKSFE 265 VQ KP+ A+ PTCL + K+ IP+F++SL SL+ K+ K ++ SGS NKM A+MKS + Sbjct: 117 VQRKPSSAKT--PTCLGDWKILIPSFVRSLISLKGKKDGKKKKPSGSGTNKMTALMKSIK 174 Query: 266 VQKKMGFVSKMLRTLK 313 VQKK GF+ K+ TL+ Sbjct: 175 VQKKRGFIPKLCSTLQ 190 >ref|XP_006440168.1| hypothetical protein CICLE_v10023888mg [Citrus clementina] gi|557542430|gb|ESR53408.1| hypothetical protein CICLE_v10023888mg [Citrus clementina] Length = 193 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 89 VQSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKRK-KNRRNSGSTANKMKAVMKSFE 265 VQ KP+ A+ PTCL + K+ IP+F++SL SL+ K+ K ++ SGS NKMKA+MKS + Sbjct: 117 VQRKPSSAKT--PTCLGDWKILIPSFIRSLISLKGKKDGKKKKPSGSGTNKMKALMKSIK 174 Query: 266 VQKKMGFVSKMLRTL 310 V KK GF+ K+ TL Sbjct: 175 VPKKRGFIPKLCSTL 189 >ref|XP_003635079.1| PREDICTED: uncharacterized protein LOC100852443 [Vitis vinifera] gi|297745672|emb|CBI40926.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/76 (42%), Positives = 53/76 (69%), Gaps = 5/76 (6%) Frame = +2 Query: 92 QSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKR-----KKNRRNSGSTANKMKAVMK 256 QSKP ++ P CL + K+SI + ++S S+QAK+ KK ++++GS+ + AVMK Sbjct: 104 QSKPK--HEKVPACLGDWKLSIASLVRSFTSVQAKKTSNKKKKKKKDNGSSRANIAAVMK 161 Query: 257 SFEVQKKMGFVSKMLR 304 + +VQKK+GF+SK+L+ Sbjct: 162 NLKVQKKLGFISKLLK 177 >ref|XP_006359212.1| PREDICTED: uncharacterized protein LOC102590703 [Solanum tuberosum] Length = 169 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/76 (40%), Positives = 46/76 (60%) Frame = +2 Query: 86 VVQSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKRKKNRRNSGSTANKMKAVMKSFE 265 +V K P P C+ N K +P FL+S + Q K+ K ++N S NK+KA++KSF+ Sbjct: 91 IVAVKNKPKYVSVPACMGNWKFVMPRFLRSFMT-QNKKSKKKKNIASKTNKIKAMVKSFQ 149 Query: 266 VQKKMGFVSKMLRTLK 313 VQ+K G SK+ TL+ Sbjct: 150 VQRKPGLFSKVFATLR 165 >ref|XP_004245826.1| PREDICTED: uncharacterized protein LOC101248508 [Solanum lycopersicum] Length = 163 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/76 (40%), Positives = 46/76 (60%) Frame = +2 Query: 86 VVQSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKRKKNRRNSGSTANKMKAVMKSFE 265 +V K P P C+ N K +P FL+S + Q K+ K ++N S NK+KA++KSF+ Sbjct: 85 IVAVKNKPKYVSVPACMGNWKFVMPRFLRSFMT-QNKKSKKKKNMDSKTNKIKAMVKSFQ 143 Query: 266 VQKKMGFVSKMLRTLK 313 VQ+K G SK+ TL+ Sbjct: 144 VQRKPGLFSKVFATLR 159 >ref|XP_002524361.1| conserved hypothetical protein [Ricinus communis] gi|223536322|gb|EEF37972.1| conserved hypothetical protein [Ricinus communis] Length = 192 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/78 (44%), Positives = 45/78 (57%) Frame = +2 Query: 86 VVQSKPTPARQRQPTCLSNLKVSIPNFLKSLPSLQAKRKKNRRNSGSTANKMKAVMKSFE 265 VVQ KP P CL K+S F +SL +Q K K ++SGST+N AVM + + Sbjct: 119 VVQRKPK--YDNTPACLGKWKISKFKFCRSLTRVQIKNDKKTKHSGSTSN---AVMNNLK 173 Query: 266 VQKKMGFVSKMLRTLKNR 319 VQKK GF+SK L L+ R Sbjct: 174 VQKKRGFISKFLAVLQKR 191