BLASTX nr result
ID: Paeonia24_contig00024768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00024768 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba]... 85 7e-25 gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba]... 69 7e-10 emb|CBI31105.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002535140.1| conserved hypothetical protein [Ricinus comm... 55 3e-06 >gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803202|gb|AGC78937.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803285|gb|AGC79020.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 111 Score = 84.7 bits (208), Expect(2) = 7e-25 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -3 Query: 153 PLLNKGKKASTRTTFLLRADVAKCLTLLVIVSCCCGRCSFARA*TNPTNKK 1 P NKG KASTRTTFLLRAD+AKCLTLLVIV CCCG+CSFAR NPTNK+ Sbjct: 28 PKTNKGNKASTRTTFLLRADLAKCLTLLVIVPCCCGQCSFAR---NPTNKE 75 Score = 55.1 bits (131), Expect(2) = 7e-25 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 235 MFRSGIRPRTTILVVVRKARTPRTSRAPFTK*GKES 128 MFRSGIRPRTT VVVRKARTPRTSRAP T G ++ Sbjct: 1 MFRSGIRPRTTSPVVVRKARTPRTSRAPKTNKGNKA 36 >gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803201|gb|AGC78936.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803286|gb|AGC79021.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 116 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 135 FPYLVKGARDVRGVRAFRTTTRMVVLGRIPLLNIRDRG 248 FP LV GARDVRGVRAFRTTT +VVLGRIPLLNIRDRG Sbjct: 24 FPLLVLGARDVRGVRAFRTTTGLVVLGRIPLLNIRDRG 61 >emb|CBI31105.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 243 YPLCLGAGSAPERPFLWWYGRHGLRER 163 YPLCLGAGSA ERP LWWYGRHGLRER Sbjct: 189 YPLCLGAGSAQERPVLWWYGRHGLRER 215 >ref|XP_002535140.1| conserved hypothetical protein [Ricinus communis] gi|223523945|gb|EEF27246.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -1 Query: 224 RDPPQNDHSCGGTEGTDSANVPRPLY 147 RD P+ND SCGGTEGTDSANVPRPLY Sbjct: 89 RDSPKNDQSCGGTEGTDSANVPRPLY 114 Score = 21.9 bits (45), Expect(2) = 3e-06 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 318 CPGTSNEIGGR 286 C TSNEIGGR Sbjct: 77 CLRTSNEIGGR 87