BLASTX nr result
ID: Paeonia24_contig00023405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00023405 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 67 1e-16 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 67 1e-16 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 67 5e-16 gb|ABD63147.1| Integrase core domain containing protein [Asparag... 54 3e-07 gb|ABD63115.1| hypothetical protein 18.t00011 [Asparagus officin... 50 8e-07 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 67.4 bits (163), Expect(3) = 1e-16 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 2 FALAFTVDSEMGSGKA*EEQGKAQRFLERISKIHAEVEAQLKKSQEKYKAWHDK 163 F LAFT+ + SGK EE +A++FLERI KIH EVEAQLK+SQ++YKA HDK Sbjct: 1296 FDLAFTMSDQPLSGKEEEEHIRAKKFLERIRKIHIEVEAQLKRSQQRYKARHDK 1349 Score = 32.7 bits (73), Expect(3) = 1e-16 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 162 KHRIHCTFAERDMVWLKLGE 221 KHR+ C F E D+VWL LG+ Sbjct: 1349 KHRVPCNFKEGDLVWLHLGK 1368 Score = 31.6 bits (70), Expect(3) = 1e-16 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 208 LSWGKERLSGEGKKLKP 258 L GKERL+GEGKKLKP Sbjct: 1364 LHLGKERLTGEGKKLKP 1380 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 67.0 bits (162), Expect(3) = 1e-16 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +2 Query: 2 FALAFTVDSEMGSGKA*EEQGKAQRFLERISKIHAEVEAQLKKSQEKYKAWHDK 163 F LAFT+ + SGK EE +A++FLER+ KIH EVEAQLK+SQ++YKA HDK Sbjct: 1294 FDLAFTMSDQPLSGKEEEEHIRAKKFLERVRKIHIEVEAQLKRSQQRYKARHDK 1347 Score = 32.7 bits (73), Expect(3) = 1e-16 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 162 KHRIHCTFAERDMVWLKLGE 221 KHR+ C F E D+VWL LG+ Sbjct: 1347 KHRVPCNFKEGDLVWLHLGK 1366 Score = 31.6 bits (70), Expect(3) = 1e-16 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 208 LSWGKERLSGEGKKLKP 258 L GKERL+GEGKKLKP Sbjct: 1362 LHLGKERLTGEGKKLKP 1378 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 67.0 bits (162), Expect(3) = 5e-16 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +2 Query: 2 FALAFTVDSEMGSGKA*EEQGKAQRFLERISKIHAEVEAQLKKSQEKYKAWHDK 163 F LAFT+ + SGK EE +A++FLER+ KIH EVEAQLK+SQ++YKA HDK Sbjct: 1260 FDLAFTMSDQPLSGKEEEEHIRAKKFLERVRKIHIEVEAQLKRSQQRYKARHDK 1313 Score = 31.6 bits (70), Expect(3) = 5e-16 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 208 LSWGKERLSGEGKKLKP 258 L GKERL+GEGKKLKP Sbjct: 1328 LHLGKERLTGEGKKLKP 1344 Score = 30.8 bits (68), Expect(3) = 5e-16 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 162 KHRIHCTFAERDMVWLKLGE 221 KH + C F E D+VWL LG+ Sbjct: 1313 KHHVPCNFKEGDLVWLHLGK 1332 >gb|ABD63147.1| Integrase core domain containing protein [Asparagus officinalis] Length = 870 Score = 53.9 bits (128), Expect(2) = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 41 GKA*EEQGKAQRFLERISKIHAEVEAQLKKSQEKYKAWHDK 163 GK E+ +AQ+FLE+I+ IHA VEAQLKKSQ KYK HD+ Sbjct: 639 GKEGNERQRAQQFLEKIAHIHASVEAQLKKSQAKYKVKHDQ 679 Score = 26.2 bits (56), Expect(2) = 3e-07 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 208 LSWGKERLSGEGKKLKP 258 L GKERL GE KK KP Sbjct: 694 LKLGKERLKGEEKKSKP 710 >gb|ABD63115.1| hypothetical protein 18.t00011 [Asparagus officinalis] Length = 887 Score = 50.1 bits (118), Expect(2) = 8e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 2 FALAFTVDSEMGSGKA*EEQGKAQRFLERISKIHAEVEAQLKKSQEKYK 148 F + F+ ++ GK E+ AQRFLE+I+ IHA VEAQLKKSQ KYK Sbjct: 710 FDIVFSSEAT-ADGKEGSERQHAQRFLEKIAHIHATVEAQLKKSQSKYK 757 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 220 KERLSGEGKKLKP 258 KERL GEGKKLKP Sbjct: 757 KERLKGEGKKLKP 769