BLASTX nr result
ID: Paeonia24_contig00023362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00023362 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006487346.1| PREDICTED: RNA-binding protein 28-like isofo... 56 6e-06 ref|XP_006487344.1| PREDICTED: RNA-binding protein 28-like isofo... 56 6e-06 ref|XP_006423392.1| hypothetical protein CICLE_v10027768mg [Citr... 56 6e-06 ref|XP_006423391.1| hypothetical protein CICLE_v10027768mg [Citr... 56 6e-06 >ref|XP_006487346.1| PREDICTED: RNA-binding protein 28-like isoform X3 [Citrus sinensis] Length = 933 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 124 MGKNKKMEGSEESKYCSAKVSVSNLPYSFTVSQLEETFSDV 2 MGKNKK G E+S++ + V V+NLPYSFT SQLEE FSDV Sbjct: 1 MGKNKKNRGGEKSEHSPSTVFVNNLPYSFTNSQLEEAFSDV 41 >ref|XP_006487344.1| PREDICTED: RNA-binding protein 28-like isoform X1 [Citrus sinensis] gi|568868077|ref|XP_006487345.1| PREDICTED: RNA-binding protein 28-like isoform X2 [Citrus sinensis] Length = 938 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 124 MGKNKKMEGSEESKYCSAKVSVSNLPYSFTVSQLEETFSDV 2 MGKNKK G E+S++ + V V+NLPYSFT SQLEE FSDV Sbjct: 1 MGKNKKNRGGEKSEHSPSTVFVNNLPYSFTNSQLEEAFSDV 41 >ref|XP_006423392.1| hypothetical protein CICLE_v10027768mg [Citrus clementina] gi|557525326|gb|ESR36632.1| hypothetical protein CICLE_v10027768mg [Citrus clementina] Length = 933 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 124 MGKNKKMEGSEESKYCSAKVSVSNLPYSFTVSQLEETFSDV 2 MGKNKK G E+S++ + V V+NLPYSFT SQLEE FSDV Sbjct: 1 MGKNKKNRGGEKSEHSPSTVFVNNLPYSFTNSQLEEAFSDV 41 >ref|XP_006423391.1| hypothetical protein CICLE_v10027768mg [Citrus clementina] gi|557525325|gb|ESR36631.1| hypothetical protein CICLE_v10027768mg [Citrus clementina] Length = 710 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 124 MGKNKKMEGSEESKYCSAKVSVSNLPYSFTVSQLEETFSDV 2 MGKNKK G E+S++ + V V+NLPYSFT SQLEE FSDV Sbjct: 1 MGKNKKNRGGEKSEHSPSTVFVNNLPYSFTNSQLEEAFSDV 41