BLASTX nr result
ID: Paeonia24_contig00023354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00023354 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein ... 57 2e-06 >ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein 38 [Vitis vinifera] gi|296086448|emb|CBI32037.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 303 PFLWCLLEKGYSMAGREEATIASEKASALETAYFK 199 PFLW LLE+GYSM G++EA +A EKA ALET+YFK Sbjct: 434 PFLWRLLERGYSMTGKQEARVAGEKAMALETSYFK 468