BLASTX nr result
ID: Paeonia24_contig00022809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022809 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315441.1| mevalonate disphosphate decarboxylase family... 63 4e-08 gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharant... 62 6e-08 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis] 62 8e-08 gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia milt... 62 8e-08 dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasili... 62 8e-08 ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prun... 62 1e-07 ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative ... 62 1e-07 ref|XP_002311015.1| mevalonate disphosphate decarboxylase family... 62 1e-07 ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase... 61 1e-07 gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [... 60 2e-07 gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana l... 60 4e-07 emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera] 59 5e-07 ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase... 59 7e-07 ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase... 59 7e-07 gb|AFS28685.1| putative phosphomevalonate kinase, partial [Olea ... 59 9e-07 ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase... 59 9e-07 gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus] 58 1e-06 gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Mimulus... 57 2e-06 ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobr... 57 3e-06 ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobr... 57 3e-06 >ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] gi|222864481|gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] Length = 416 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICTKPGRGPVLLSDESQ+LL+PETGLPK Sbjct: 387 YFICTKPGRGPVLLSDESQALLHPETGLPK 416 >gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus] Length = 421 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLL++ESQSLLNPETGLPK Sbjct: 392 YFICTRPGRGPVLLTEESQSLLNPETGLPK 421 >gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis] Length = 400 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPV LSDESQ+LLNPETGLPK Sbjct: 371 YFICTRPGRGPVYLSDESQALLNPETGLPK 400 >gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza] Length = 422 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPV+L+DESQSL+NPETGLPK Sbjct: 393 YFICTRPGRGPVVLADESQSLINPETGLPK 422 >dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis] Length = 415 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLLSDESQ+LL+PETGLPK Sbjct: 386 YFICTRPGRGPVLLSDESQALLSPETGLPK 415 >ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica] gi|462407609|gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica] Length = 419 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPV+LSDESQ LLNPETGLPK Sbjct: 390 YFICTRPGRGPVVLSDESQFLLNPETGLPK 419 >ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis] gi|223539619|gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis] Length = 415 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLL+DESQ+LLNP+TGLPK Sbjct: 386 YFICTRPGRGPVLLTDESQALLNPQTGLPK 415 >ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] gi|222850835|gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] Length = 416 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICTKPGRGP LLSDESQ+LL+PETGLPK Sbjct: 387 YFICTKPGRGPALLSDESQALLHPETGLPK 416 >ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera] gi|296087980|emb|CBI35263.3| unnamed protein product [Vitis vinifera] Length = 422 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PG+GPVLLSDESQ+LLNPE+GLPK Sbjct: 393 YFICTRPGKGPVLLSDESQALLNPESGLPK 422 >gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis] Length = 415 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PG+GPVLLSDESQ+LL+PETGLPK Sbjct: 386 YFICTRPGQGPVLLSDESQALLSPETGLPK 415 >gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii x Nicotiana sanderae] Length = 406 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLL+D+S +LLNPETGLPK Sbjct: 377 YFICTRPGRGPVLLTDDSHALLNPETGLPK 406 >emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera] Length = 451 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PG+GP LLSDESQ+LLNPE+GLPK Sbjct: 378 YFICTRPGKGPXLLSDESQALLNPESGLPK 407 >ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum] Length = 421 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLLSDESQ+LLN E GLPK Sbjct: 392 YFICTRPGRGPVLLSDESQALLNSENGLPK 421 >ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum] Length = 421 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVL+SD+SQ+LL+P+TGLPK Sbjct: 392 YFICTRPGRGPVLISDDSQALLHPDTGLPK 421 >gb|AFS28685.1| putative phosphomevalonate kinase, partial [Olea europaea] Length = 40 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICTKPGRGPVLL++ESQ+LL+P+TGLPK Sbjct: 11 YFICTKPGRGPVLLTNESQALLDPKTGLPK 40 >ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max] Length = 420 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLLSD SQ+LLN ETGLPK Sbjct: 391 YFICTRPGRGPVLLSDSSQALLNGETGLPK 420 >gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus] Length = 417 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPV+LSDESQ+LL+P TGLPK Sbjct: 388 YFICTRPGRGPVVLSDESQALLDPVTGLPK 417 >gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Mimulus guttatus] Length = 421 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPV+L+DES+SL+N ETGLPK Sbjct: 392 YFICTRPGRGPVVLNDESRSLINSETGLPK 421 >ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao] gi|508727228|gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao] Length = 417 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLL++E+ +LLNPETGLPK Sbjct: 388 YFICTRPGRGPVLLTNENLALLNPETGLPK 417 >ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao] gi|508727227|gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao] Length = 418 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 323 YFICTKPGRGPVLLSDESQSLLNPETGLPK 234 YFICT+PGRGPVLL++E+ +LLNPETGLPK Sbjct: 389 YFICTRPGRGPVLLTNENLALLNPETGLPK 418