BLASTX nr result
ID: Paeonia24_contig00021880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021880 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citr... 64 2e-08 ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Popu... 63 5e-08 ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Popu... 63 5e-08 ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402... 60 2e-07 emb|CBI36966.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Popu... 59 9e-07 ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|EXB28566.1| hypothetical protein L484_009725 [Morus notabilis] 57 3e-06 ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus... 55 8e-06 >ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Citrus sinensis] Length = 877 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G +VA+WL+ESGTLKVLVLHDDR H E + FD + N++TLTL Sbjct: 834 STGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTLTL 877 >ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] gi|557546795|gb|ESR57773.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] Length = 877 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G +VA+WL+ESGTLKVLVLHDDR H E + FD + N++TLTL Sbjct: 834 STGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTLTL 877 >ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345388|gb|ERP64510.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 873 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+VVA+WL+ESGTLKVLVLHDDR HQE F +I NL+ L L Sbjct: 830 STGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQMLQL 873 >ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345387|gb|EEE80792.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 864 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+VVA+WL+ESGTLKVLVLHDDR HQE F +I NL+ L L Sbjct: 821 STGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQMLQL 864 >ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+VVAAWLKESGTLK+LVLHDDR H +T D I L+T++L Sbjct: 825 STGSVVAAWLKESGTLKLLVLHDDRTHPDTENMDLISKLQTISL 868 >ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+VVAAWLKESGTLK+LVLHDDR H ++ D I L+T++L Sbjct: 825 STGSVVAAWLKESGTLKLLVLHDDRTHPDSENMDLISKLQTISL 868 >ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402|gb|EOX95298.1| S uncoupled 1 [Theobroma cacao] Length = 866 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G VV AWL+ESGTLK+LVLHDDR E + F +I NL+TLTL Sbjct: 823 STGPVVTAWLRESGTLKLLVLHDDRTQPENTGFGQISNLQTLTL 866 >emb|CBI36966.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S GAVVAAWL+ESGTLKVLVLHDDR + + + +I NL+TL L Sbjct: 687 STGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQTLPL 730 >ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Vitis vinifera] Length = 867 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S GAVVAAWL+ESGTLKVLVLHDDR + + + +I NL+TL L Sbjct: 824 STGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQTLPL 867 >ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] gi|550323986|gb|EEE99285.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] Length = 875 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+VVAAWL+ESGTLKVLVLHD R QE F + NL+TL L Sbjct: 832 STGSVVAAWLRESGTLKVLVLHDHRTEQENLRFGQASNLQTLQL 875 >ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 841 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S GAVV AWL+ESGTL+VLVL DD +H + FD+I NL+ LTL Sbjct: 798 STGAVVTAWLRESGTLEVLVLQDDTSHLRATRFDQISNLQQLTL 841 >ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 870 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S G+V AAWLKESGTL+VL+LHDDRA ++ F +I +LR L L Sbjct: 827 STGSVAAAWLKESGTLEVLMLHDDRAEPNSANFGQISDLRALAL 870 >gb|EXB28566.1| hypothetical protein L484_009725 [Morus notabilis] Length = 871 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTL 245 SPG +VA WLKESGTLKVLVLHDDR+H + + + NL+TL Sbjct: 829 SPGPMVAGWLKESGTLKVLVLHDDRSHSQNA--KHVSNLQTL 868 >ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Solanum tuberosum] Length = 848 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQETSTFDRIPNLRTLTL 239 S GAVV AWL+ESGTL+VLVL DD +H + F +I NL+ LTL Sbjct: 805 STGAVVTAWLRESGTLEVLVLQDDTSHLRATRFGQISNLQQLTL 848 >gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus guttatus] Length = 843 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 5/49 (10%) Frame = -1 Query: 370 SPGAVVAAWLKESGTLKVLVLHDDRAHQET-----STFDRIPNLRTLTL 239 S G+VV AWL+ESG+LKVLVL DDR H T + FDRIPN + L L Sbjct: 795 STGSVVTAWLRESGSLKVLVLQDDRTHTGTISSSSTRFDRIPNFQPLPL 843