BLASTX nr result
ID: Paeonia24_contig00021431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021431 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B ... 63 4e-08 ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B ... 63 4e-08 ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phas... 59 5e-07 ref|XP_006446663.1| hypothetical protein CICLE_v10016241mg [Citr... 59 7e-07 ref|XP_006446662.1| hypothetical protein CICLE_v10016241mg [Citr... 59 7e-07 gb|AFK43542.1| unknown [Lotus japonicus] 59 9e-07 ref|XP_007142405.1| hypothetical protein PHAVU_008G277700g [Phas... 57 3e-06 ref|XP_007133840.1| hypothetical protein PHAVU_011G213400g [Phas... 57 3e-06 ref|XP_007031655.1| N-terminal nucleophile aminohydrolases (Ntn ... 57 4e-06 ref|XP_004139648.1| PREDICTED: proteasome subunit beta type-7-B-... 56 6e-06 ref|XP_003519624.1| PREDICTED: proteasome subunit beta type-7-B-... 55 8e-06 >ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B isoform 2 [Vitis vinifera] Length = 267 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 +V+ KGY+FPKPIEVL TK+TPLK+KVEVIEGG+AM Sbjct: 230 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAM 265 >ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B isoform 1 [Vitis vinifera] gi|296081387|emb|CBI16820.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 +V+ KGY+FPKPIEVL TK+TPLK+KVEVIEGG+AM Sbjct: 236 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAM 271 >ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] gi|561034408|gb|ESW32938.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] Length = 271 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEG 196 +VNPKG+ FPK IEVLSTKITPLK+KVEVIEG Sbjct: 235 YVNPKGFEFPKKIEVLSTKITPLKEKVEVIEG 266 >ref|XP_006446663.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] gi|557549274|gb|ESR59903.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] Length = 250 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 FVN KGY+FPK EVL TKITPL+++VEV+EGG+AM Sbjct: 213 FVNAKGYSFPKKTEVLLTKITPLRERVEVVEGGDAM 248 >ref|XP_006446662.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] gi|568831934|ref|XP_006470201.1| PREDICTED: proteasome subunit beta type-7-B-like [Citrus sinensis] gi|557549273|gb|ESR59902.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] Length = 273 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 FVN KGY+FPK EVL TKITPL+++VEV+EGG+AM Sbjct: 236 FVNAKGYSFPKKTEVLLTKITPLRERVEVVEGGDAM 271 >gb|AFK43542.1| unknown [Lotus japonicus] Length = 272 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 +VNPKG+ F K EVL TKITPLK+KVEVIEGG+AM Sbjct: 235 YVNPKGFTFSKKTEVLLTKITPLKEKVEVIEGGDAM 270 >ref|XP_007142405.1| hypothetical protein PHAVU_008G277700g [Phaseolus vulgaris] gi|561015538|gb|ESW14399.1| hypothetical protein PHAVU_008G277700g [Phaseolus vulgaris] Length = 271 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEG 196 +VNPKG+ FPK IEVL TKITPLK+KVEVIEG Sbjct: 235 YVNPKGFEFPKKIEVLLTKITPLKEKVEVIEG 266 >ref|XP_007133840.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|593263324|ref|XP_007133841.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|561006840|gb|ESW05834.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|561006841|gb|ESW05835.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] Length = 271 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEG 196 +VNPKG+ FPK IEVL TKITPLK+KVEVIEG Sbjct: 235 YVNPKGFEFPKKIEVLLTKITPLKEKVEVIEG 266 >ref|XP_007031655.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein [Theobroma cacao] gi|508710684|gb|EOY02581.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein [Theobroma cacao] Length = 273 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 + + KGY+FPK EVL TKITPLK+KVE+IEGG+AM Sbjct: 236 YTSSKGYSFPKKTEVLLTKITPLKEKVEIIEGGDAM 271 >ref|XP_004139648.1| PREDICTED: proteasome subunit beta type-7-B-like [Cucumis sativus] gi|449475427|ref|XP_004154453.1| PREDICTED: proteasome subunit beta type-7-B-like [Cucumis sativus] Length = 273 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEGGEAM 184 +V+ KGY+FPK EVL TKI PLK+KVE+IEGG+AM Sbjct: 236 YVSSKGYSFPKKTEVLLTKIMPLKEKVEIIEGGDAM 271 >ref|XP_003519624.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X1 [Glycine max] gi|356552635|ref|XP_003544669.1| PREDICTED: proteasome subunit beta type-7-B-like isoformX1 [Glycine max] gi|356552637|ref|XP_003544670.1| PREDICTED: proteasome subunit beta type-7-B-like isoformX2 [Glycine max] gi|571442369|ref|XP_006575709.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X2 [Glycine max] gi|571506377|ref|XP_006595695.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X3 [Glycine max] Length = 271 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 291 FVNPKGYNFPKPIEVLSTKITPLKQKVEVIEG 196 +VNPKG++FPK EVL TKITPLK+KVEVIEG Sbjct: 235 YVNPKGFDFPKKTEVLLTKITPLKEKVEVIEG 266