BLASTX nr result
ID: Paeonia24_contig00021422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021422 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Popu... 60 2e-07 ref|XP_002309943.2| hypothetical protein POPTR_0007s04750g [Popu... 59 7e-07 >ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] gi|550344355|gb|EEE80134.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] Length = 979 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = +3 Query: 6 VRLRMFNNLTQTETTISFLPAVSEEEKGIYSIYIPGSVIPNWYSHQNEGNSVSFIVP--- 176 + + + NNLT+ TIS L A+SE K IYSI++P S IP W+SHQNEG+SVS VP Sbjct: 710 INVHVINNLTRA-ATISPLQALSE--KSIYSIFLPMSDIPTWFSHQNEGDSVSLQVPPLD 766 Query: 177 HKSDITGF 200 H +GF Sbjct: 767 HGCKFSGF 774 >ref|XP_002309943.2| hypothetical protein POPTR_0007s04750g [Populus trichocarpa] gi|550334142|gb|EEE90393.2| hypothetical protein POPTR_0007s04750g [Populus trichocarpa] Length = 1105 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/59 (45%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = +3 Query: 6 VRLRMFNNLTQTE--TTISFLPAVSEEEKGIYSIYIPGSVIPNWYSHQNEGNSVSFIVP 176 + + M N++T+T T + L +E+GI+SI++PGS +P+WYSHQ + NSVSF VP Sbjct: 911 IEVEMINSITKTSRITRLQIL-----QEQGIFSIFLPGSEVPSWYSHQKQNNSVSFAVP 964