BLASTX nr result
ID: Paeonia24_contig00020917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020917 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289821.1| PREDICTED: oligopeptide transporter 4-like [... 58 2e-06 ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [... 56 5e-06 ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phas... 56 6e-06 gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partia... 55 8e-06 >ref|XP_004289821.1| PREDICTED: oligopeptide transporter 4-like [Fragaria vesca subsp. vesca] Length = 740 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 146 HTRFMRKCKDKPSWWFYI*FGVTLAVSLLLCIFL 247 HTR MRK KD PSWWFY+ VTLAVSL LCIFL Sbjct: 409 HTRLMRKYKDIPSWWFYLLLAVTLAVSLALCIFL 442 >ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [Glycine max] Length = 746 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 146 HTRFMRKCKDKPSWWFYI*FGVTLAVSLLLCIFL 247 HT+ M+K KD P+WWFY+ GVTL VSL+LCIFL Sbjct: 414 HTKLMKKYKDIPTWWFYVMMGVTLVVSLVLCIFL 447 >ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris] gi|561032594|gb|ESW31173.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris] Length = 738 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 146 HTRFMRKCKDKPSWWFYI*FGVTLAVSLLLCIFL 247 HT+ M+K KD PSWWF++ GVTL VSL+LCIFL Sbjct: 406 HTKMMKKYKDIPSWWFHVMLGVTLVVSLMLCIFL 439 >gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partial [Mimulus guttatus] Length = 569 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +2 Query: 146 HTRFMRKCKDKPSWWFYI*FGVTLAVSLLLCIFL 247 HTR MR+ +D PSWWFYI VTLA SL+LCIFL Sbjct: 237 HTRLMRRYEDIPSWWFYILLAVTLAASLILCIFL 270