BLASTX nr result
ID: Paeonia24_contig00020859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020859 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528881.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_002528886.1| S-locus-specific glycoprotein S6 precursor, ... 60 2e-07 ref|XP_006370400.1| hypothetical protein POPTR_0001s42260g [Popu... 58 2e-06 ref|XP_006370399.1| hypothetical protein POPTR_0001s42260g [Popu... 58 2e-06 ref|XP_006475274.1| PREDICTED: uncharacterized protein LOC102626... 57 2e-06 ref|XP_006452078.1| hypothetical protein CICLE_v10010587mg [Citr... 57 2e-06 ref|XP_006370371.1| S-locus protein kinase [Populus trichocarpa]... 57 2e-06 ref|XP_006377797.1| hypothetical protein POPTR_0011s12930g [Popu... 57 2e-06 ref|XP_006370372.1| hypothetical protein POPTR_0001s42070g [Popu... 57 2e-06 gb|EXC10161.1| G-type lectin S-receptor-like serine/threonine-pr... 57 3e-06 ref|XP_007021201.1| S-locus lectin protein kinase family protein... 56 6e-06 ref|XP_002534814.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002528881.1| conserved hypothetical protein [Ricinus communis] gi|223531680|gb|EEF33505.1| conserved hypothetical protein [Ricinus communis] Length = 2428 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLS E LP+P++PGFFTERKL KTD+ SS +E S+N +T+T++ R Sbjct: 2379 VLMLSGEGALPEPKEPGFFTERKLIKTDSSSSKYESCSINEVTITMIGAR 2428 >ref|XP_002528886.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] gi|223531685|gb|EEF33510.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] Length = 614 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/50 (56%), Positives = 39/50 (78%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLML+S+I LPQP++PGFFTERK+F+ D+ SS + S N +T+TL+ R Sbjct: 565 VLMLTSDISLPQPKEPGFFTERKVFEQDSSSSKVDTCSANEITITLLDAR 614 >ref|XP_006370400.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa] gi|550349579|gb|ERP66969.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa] Length = 833 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLS E LPQP++PGFFTERKL + SS E SVN +T+TL+ R Sbjct: 784 VLMLSGEGTLPQPKEPGFFTERKLIDASSSSSKPESCSVNEVTITLIDAR 833 >ref|XP_006370399.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa] gi|550349578|gb|ERP66968.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa] Length = 781 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLS E LPQP++PGFFTERKL + SS E SVN +T+TL+ R Sbjct: 732 VLMLSGEGTLPQPKEPGFFTERKLIDASSSSSKPESCSVNEVTITLIDAR 781 >ref|XP_006475274.1| PREDICTED: uncharacterized protein LOC102626881 [Citrus sinensis] Length = 1681 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLS E LPQP+QPGFFTER L ++++ SS+ F S N +TV+L+ R Sbjct: 1632 VLMLSGERSLPQPKQPGFFTERNLPESESSSSNQTFHSSNQITVSLIEGR 1681 >ref|XP_006452078.1| hypothetical protein CICLE_v10010587mg [Citrus clementina] gi|557555304|gb|ESR65318.1| hypothetical protein CICLE_v10010587mg [Citrus clementina] Length = 808 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLS E LPQP+QPGFFTER L ++++ SS+ F S N +TV+L+ R Sbjct: 759 VLMLSGERSLPQPKQPGFFTERNLPESESSSSNQTFHSSNQITVSLIEGR 808 >ref|XP_006370371.1| S-locus protein kinase [Populus trichocarpa] gi|550349550|gb|ERP66940.1| S-locus protein kinase [Populus trichocarpa] Length = 831 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLSS+I LPQP++PGFFTER L + + HE SVN +T TL+ R Sbjct: 782 VLMLSSDIVLPQPKEPGFFTERDLSNDSSSTIKHEISSVNELTSTLLEAR 831 >ref|XP_006377797.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa] gi|550328270|gb|ERP55594.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa] Length = 817 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLMLSS I LP P++PGFFTERKLF ++ SS + S N +T+TL++ R Sbjct: 768 VLMLSSNIALPDPKEPGFFTERKLFDHESSSSKVDTCSANEITITLLTAR 817 >ref|XP_006370372.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa] gi|550349551|gb|ERP66941.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa] Length = 773 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLML+S I LP+P++PGFFTERKLF ++ SS + S N +T+TL++ R Sbjct: 724 VLMLTSNITLPEPKEPGFFTERKLFDQESSSSKVDSCSANEITITLLTAR 773 >gb|EXC10161.1| G-type lectin S-receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 751 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRS-VNTMTVTLVSPR 150 VLMLSSEI LP P++PGFFTER L TD+ S+ HE S +N +T+T++ R Sbjct: 701 VLMLSSEIALPTPKEPGFFTERHLSDTDSSSTKHEQPSTINRVTITVLEAR 751 >ref|XP_007021201.1| S-locus lectin protein kinase family protein, putative [Theobroma cacao] gi|508720829|gb|EOY12726.1| S-locus lectin protein kinase family protein, putative [Theobroma cacao] Length = 823 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 +LML SE LPQP+QPGFFTER L + ++ +S+ + S N TVTL+ PR Sbjct: 774 ILMLGSESALPQPKQPGFFTERNLPEAESSTSNCKSSSANECTVTLLEPR 823 >ref|XP_002534814.1| conserved hypothetical protein [Ricinus communis] gi|223524531|gb|EEF27568.1| conserved hypothetical protein [Ricinus communis] Length = 138 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +1 Query: 1 VLMLSSEIELPQPQQPGFFTERKLFKTDTLSSSHEFRSVNTMTVTLVSPR 150 VLML E LPQP+QPGFFTER L + ++ SS ++ S N +T+T++ PR Sbjct: 89 VLMLGGESSLPQPKQPGFFTERNLPEDESSSSYYKSTSTNEITMTMLEPR 138