BLASTX nr result
ID: Paeonia24_contig00020567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020567 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69118.1| hypothetical protein VITISV_031845 [Vitis vinifera] 50 8e-06 ref|XP_002284797.2| PREDICTED: tRNA pseudouridine synthase A, mi... 50 8e-06 emb|CBI18897.3| unnamed protein product [Vitis vinifera] 50 8e-06 >emb|CAN69118.1| hypothetical protein VITISV_031845 [Vitis vinifera] Length = 559 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 223 YVYLIPVFALDPYSHLDREDVLASVGYEMTLL 318 YVYLIPVFALDP SH DRE VLASVG E L+ Sbjct: 142 YVYLIPVFALDPSSHPDRESVLASVGSENELV 173 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +3 Query: 306 NDLIKCLECSD 338 N+L+KCLECS+ Sbjct: 170 NELVKCLECSE 180 >ref|XP_002284797.2| PREDICTED: tRNA pseudouridine synthase A, mitochondrial-like [Vitis vinifera] Length = 503 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 223 YVYLIPVFALDPYSHLDREDVLASVGYEMTLL 318 YVYLIPVFALDP SH DRE VLASVG E L+ Sbjct: 154 YVYLIPVFALDPSSHPDRESVLASVGSENELV 185 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +3 Query: 306 NDLIKCLECSD 338 N+L+KCLECS+ Sbjct: 182 NELVKCLECSE 192 >emb|CBI18897.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 223 YVYLIPVFALDPYSHLDREDVLASVGYEMTLL 318 YVYLIPVFALDP SH DRE VLASVG E L+ Sbjct: 100 YVYLIPVFALDPSSHPDRESVLASVGSENELV 131 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +3 Query: 306 NDLIKCLECSD 338 N+L+KCLECS+ Sbjct: 128 NELVKCLECSE 138