BLASTX nr result
ID: Paeonia24_contig00020191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020191 (852 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515072.1| pentatricopeptide repeat-containing protein,... 82 2e-13 ref|XP_007219034.1| hypothetical protein PRUPE_ppa004557mg [Prun... 81 6e-13 ref|XP_004306649.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 ref|XP_006491362.1| PREDICTED: pentatricopeptide repeat-containi... 77 8e-12 ref|XP_006444734.1| hypothetical protein CICLE_v10019806mg [Citr... 77 8e-12 ref|XP_007041542.1| Tetratricopeptide repeat (TPR)-like superfam... 75 2e-11 ref|XP_006386647.1| hypothetical protein POPTR_0002s18000g [Popu... 72 2e-10 ref|XP_002301440.2| pentatricopeptide repeat-containing family p... 72 2e-10 ref|XP_007152653.1| hypothetical protein PHAVU_004G147700g [Phas... 72 4e-10 ref|XP_003619886.1| Pentatricopeptide repeat-containing protein ... 71 5e-10 ref|XP_002268415.1| PREDICTED: pentatricopeptide repeat-containi... 71 5e-10 emb|CBI38708.3| unnamed protein product [Vitis vinifera] 71 5e-10 ref|XP_004140638.1| PREDICTED: pentatricopeptide repeat-containi... 71 6e-10 ref|XP_004512775.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_003614316.1| Pentatricopeptide repeat-containing protein ... 70 1e-09 ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_002889556.1| pentatricopeptide repeat-containing protein ... 65 4e-08 ref|XP_006357649.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_006306345.1| hypothetical protein CARUB_v10012229mg [Caps... 64 7e-08 ref|XP_004243578.1| PREDICTED: pentatricopeptide repeat-containi... 64 7e-08 >ref|XP_002515072.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545552|gb|EEF47056.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 M++RWPRLL+PTHLSQIIRNQKNP ALRIFKEAK KYPNYRH Sbjct: 1 MTVRWPRLLTPTHLSQIIRNQKNPLIALRIFKEAKDKYPNYRH 43 >ref|XP_007219034.1| hypothetical protein PRUPE_ppa004557mg [Prunus persica] gi|462415496|gb|EMJ20233.1| hypothetical protein PRUPE_ppa004557mg [Prunus persica] Length = 503 Score = 80.9 bits (198), Expect = 6e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPRLL+PTHLSQIIR QKNP TAL+IF EAK KYPNYRH Sbjct: 1 MSIRWPRLLTPTHLSQIIRKQKNPLTALQIFSEAKCKYPNYRH 43 >ref|XP_004306649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Fragaria vesca subsp. vesca] Length = 506 Score = 77.4 bits (189), Expect = 6e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPRLLSPT+LSQIIR QKNP TAL+IF EA+ KYPNYRH Sbjct: 1 MSIRWPRLLSPTNLSQIIRMQKNPLTALKIFSEAQSKYPNYRH 43 >ref|XP_006491362.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Citrus sinensis] Length = 504 Score = 77.0 bits (188), Expect = 8e-12 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS+RWPRLL+PT+LSQII+ QK+P TAL+IFKEAK KYPNYRH Sbjct: 1 MSVRWPRLLTPTYLSQIIKKQKSPLTALKIFKEAKEKYPNYRH 43 >ref|XP_006444734.1| hypothetical protein CICLE_v10019806mg [Citrus clementina] gi|557546996|gb|ESR57974.1| hypothetical protein CICLE_v10019806mg [Citrus clementina] Length = 504 Score = 77.0 bits (188), Expect = 8e-12 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS+RWPRLL+PT+LSQII+ QK+P TAL+IFKEAK KYPNYRH Sbjct: 1 MSVRWPRLLTPTYLSQIIKKQKSPLTALKIFKEAKEKYPNYRH 43 >ref|XP_007041542.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508705477|gb|EOX97373.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 500 Score = 75.5 bits (184), Expect = 2e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PTHL+QIIR QKNP TAL+IF +A+ KYPNYRH Sbjct: 1 MSIRWPRVLTPTHLAQIIRTQKNPLTALQIFNQAQQKYPNYRH 43 >ref|XP_006386647.1| hypothetical protein POPTR_0002s18000g [Populus trichocarpa] gi|550345261|gb|ERP64444.1| hypothetical protein POPTR_0002s18000g [Populus trichocarpa] Length = 467 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPRLL+PT LSQI+R QKNP TAL+IFK+AK KYP+Y H Sbjct: 1 MSIRWPRLLTPTQLSQILRCQKNPLTALQIFKDAKDKYPSYHH 43 >ref|XP_002301440.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550345260|gb|EEE80713.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 503 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPRLL+PT LSQI+R QKNP TAL+IFK+AK KYP+Y H Sbjct: 1 MSIRWPRLLTPTQLSQILRCQKNPLTALQIFKDAKDKYPSYHH 43 >ref|XP_007152653.1| hypothetical protein PHAVU_004G147700g [Phaseolus vulgaris] gi|561025962|gb|ESW24647.1| hypothetical protein PHAVU_004G147700g [Phaseolus vulgaris] Length = 502 Score = 71.6 bits (174), Expect = 4e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PT+LSQIIR QKNP AL IF EAK +YPNY H Sbjct: 1 MSIRWPRVLTPTYLSQIIRTQKNPIKALHIFNEAKSRYPNYHH 43 >ref|XP_003619886.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355494901|gb|AES76104.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 576 Score = 71.2 bits (173), Expect = 5e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PT+L+QIIR QKNP AL IF EAK KYPNY H Sbjct: 1 MSIRWPRVLNPTYLTQIIRTQKNPLKALEIFNEAKSKYPNYSH 43 >ref|XP_002268415.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Vitis vinifera] Length = 503 Score = 71.2 bits (173), Expect = 5e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS++WPR L PT LSQ+IR QKNP TAL+IF EAK K+PNYRH Sbjct: 1 MSVKWPRFLIPTQLSQMIRTQKNPLTALKIFNEAKSKFPNYRH 43 >emb|CBI38708.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 71.2 bits (173), Expect = 5e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS++WPR L PT LSQ+IR QKNP TAL+IF EAK K+PNYRH Sbjct: 1 MSVKWPRFLIPTQLSQMIRTQKNPLTALKIFNEAKSKFPNYRH 43 >ref|XP_004140638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Cucumis sativus] gi|449526108|ref|XP_004170056.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Cucumis sativus] Length = 497 Score = 70.9 bits (172), Expect = 6e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PT LSQIIR Q NP TA ++FKEAK +YP+YRH Sbjct: 1 MSIRWPRILTPTCLSQIIRKQNNPQTAYQLFKEAKCRYPDYRH 43 >ref|XP_004512775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Cicer arietinum] Length = 502 Score = 70.5 bits (171), Expect = 8e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PT+LSQIIR QKNP AL+IF EAK KYP Y H Sbjct: 1 MSIRWPRVLTPTYLSQIIRTQKNPLKALQIFNEAKSKYPKYSH 43 >ref|XP_003614316.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515651|gb|AES97274.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 504 Score = 70.1 bits (170), Expect = 1e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 721 NMSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 +MSIRWPR+L+PT+L+QIIR QKNP AL IF EAK KYP Y H Sbjct: 2 SMSIRWPRVLNPTYLTQIIRTQKNPLKALEIFNEAKLKYPKYSH 45 >ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Glycine max] Length = 502 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MSIRWPR+L+PT+LSQII+ QKNP AL IF EAK +YPNY H Sbjct: 1 MSIRWPRVLTPTYLSQIIKTQKNPLKALNIFNEAKSRYPNYYH 43 >ref|XP_002889556.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335398|gb|EFH65815.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 503 Score = 64.7 bits (156), Expect = 4e-08 Identities = 26/43 (60%), Positives = 38/43 (88%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS+RWPR+L+P+ LSQI++ QKNP TAL++F+EAK ++P+Y H Sbjct: 1 MSVRWPRVLTPSLLSQILKKQKNPVTALKLFEEAKVRFPSYGH 43 >ref|XP_006357649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like isoform X1 [Solanum tuberosum] Length = 503 Score = 64.3 bits (155), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 M IRWPR+L+P LSQII +QKNP AL+ F EAK KYP YRH Sbjct: 1 MGIRWPRILTPKQLSQIILSQKNPLKALQFFDEAKCKYPTYRH 43 >ref|XP_006306345.1| hypothetical protein CARUB_v10012229mg [Capsella rubella] gi|482575056|gb|EOA39243.1| hypothetical protein CARUB_v10012229mg [Capsella rubella] Length = 503 Score = 63.9 bits (154), Expect = 7e-08 Identities = 26/43 (60%), Positives = 38/43 (88%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 MS+RWPR+L+P+ LSQI++ QKNP TAL++F+EAK ++P+Y H Sbjct: 1 MSVRWPRVLTPSLLSQILKKQKNPVTALKLFEEAKERFPSYGH 43 >ref|XP_004243578.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like isoform 1 [Solanum lycopersicum] gi|460396023|ref|XP_004243579.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like isoform 2 [Solanum lycopersicum] Length = 503 Score = 63.9 bits (154), Expect = 7e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +1 Query: 724 MSIRWPRLLSPTHLSQIIRNQKNPSTALRIFKEAKFKYPNYRH 852 M IRWPR+L+P LSQII +QKNP AL+ F EAK KYP YRH Sbjct: 1 MGIRWPRILTPKQLSQIILSQKNPLKALQCFDEAKCKYPTYRH 43