BLASTX nr result
ID: Paeonia24_contig00018867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018867 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616512.1| Protein NEDD1 [Medicago truncatula] gi|35551... 56 2e-06 ref|XP_007009189.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007009185.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007009184.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 >ref|XP_003616512.1| Protein NEDD1 [Medicago truncatula] gi|355517847|gb|AES99470.1| Protein NEDD1 [Medicago truncatula] Length = 819 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +3 Query: 90 LTLLSCDLIE*KEMSTVMSSILENQAELMKEVQSLQKENQKFHQLL 227 ++L+ C L++ EMST M+SILENQAEL+KEV+SL+KEN++ QLL Sbjct: 775 ISLIKC-LVQQMEMSTAMNSILENQAELLKEVKSLRKENEQLRQLL 819 Score = 20.8 bits (42), Expect(2) = 2e-06 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 1 IEILRQFRTRGIFIYN 48 +EILRQF + + I+N Sbjct: 751 LEILRQFHLQEVCIWN 766 >ref|XP_007009189.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma cacao] gi|508726102|gb|EOY17999.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma cacao] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 126 EMSTVMSSILENQAELMKEVQSLQKENQKFHQLL 227 EMS VMSSILENQAELMKEVQSL+KENQ+ QLL Sbjct: 136 EMSRVMSSILENQAELMKEVQSLRKENQQIRQLL 169 >ref|XP_007009185.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508726098|gb|EOY17995.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 796 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 126 EMSTVMSSILENQAELMKEVQSLQKENQKFHQLL 227 EMS VMSSILENQAELMKEVQSL+KENQ+ QLL Sbjct: 763 EMSRVMSSILENQAELMKEVQSLRKENQQLRQLL 796 >ref|XP_007009184.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508726097|gb|EOY17994.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 822 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 126 EMSTVMSSILENQAELMKEVQSLQKENQKFHQLL 227 EMS VMSSILENQAELMKEVQSL+KENQ+ QLL Sbjct: 789 EMSRVMSSILENQAELMKEVQSLRKENQQLRQLL 822