BLASTX nr result
ID: Paeonia24_contig00018832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018832 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007049745.1| DNA binding protein, putative isoform 2 [The... 59 9e-07 ref|XP_007049744.1| DNA binding protein, putative isoform 1 [The... 59 9e-07 >ref|XP_007049745.1| DNA binding protein, putative isoform 2 [Theobroma cacao] gi|508702006|gb|EOX93902.1| DNA binding protein, putative isoform 2 [Theobroma cacao] Length = 846 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = -3 Query: 212 KIGDPLTGRGCIQVWCVLNARVSEEEVPSLKKRPKQVRRNNETVNTS 72 KIG PLTGRG IQ+WC+LN V EEE P KKRPK + E + S Sbjct: 160 KIGTPLTGRGIIQIWCMLNVGVEEEEAPLSKKRPKWRSQTTEAMEES 206 >ref|XP_007049744.1| DNA binding protein, putative isoform 1 [Theobroma cacao] gi|508702005|gb|EOX93901.1| DNA binding protein, putative isoform 1 [Theobroma cacao] Length = 868 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = -3 Query: 212 KIGDPLTGRGCIQVWCVLNARVSEEEVPSLKKRPKQVRRNNETVNTS 72 KIG PLTGRG IQ+WC+LN V EEE P KKRPK + E + S Sbjct: 160 KIGTPLTGRGIIQIWCMLNVGVEEEEAPLSKKRPKWRSQTTEAMEES 206