BLASTX nr result
ID: Paeonia24_contig00018735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018735 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 55 8e-06 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/45 (46%), Positives = 33/45 (73%) Frame = -3 Query: 178 ISRELQNKKKQGTVFKVDF*RAFDFVDWNFIGRTLLEKGFGPYWR 44 + E++ +K++G VFK+DF +A+D V+WNF+ L+ KGFG WR Sbjct: 542 VVEEVRKQKRKGLVFKIDFEKAYDHVEWNFVDDVLVRKGFGAKWR 586