BLASTX nr result
ID: Paeonia24_contig00018339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018339 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20016.1| Phosphate transporter PHO1-3-like protein [Morus ... 56 5e-06 >gb|EXC20016.1| Phosphate transporter PHO1-3-like protein [Morus notabilis] Length = 794 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 4/61 (6%) Frame = -1 Query: 171 EKPNT-RASRQAPLDLLE---CTKTYETTCLNIKGILSVPKEIELQLSRENLKIVEQQLK 4 EKP + RASR APL++L T ET IKG+L+VPK+ EL +RENL+ VE QLK Sbjct: 237 EKPRSIRASRPAPLEVLNRVTMNNTIETPRSTIKGVLNVPKQTELNFNRENLRKVEAQLK 296 Query: 3 R 1 R Sbjct: 297 R 297