BLASTX nr result
ID: Paeonia24_contig00018214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00018214 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267385.2| PREDICTED: probable receptor-like protein ki... 57 3e-06 >ref|XP_002267385.2| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 586 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -2 Query: 395 WCIQWYPMDRPSMKVALQMLEGQGXXXXXXXXPFSSAADQTRL 267 WCIQWYP+DRPSMKVA+QMLEG+G PF+S Q ++ Sbjct: 544 WCIQWYPIDRPSMKVAVQMLEGEGDNLTMPPNPFASWVQQEQI 586